Roseobase: Ruegeria pomeroyi DSS-3

Name: mutT
Type: gene
Description:
Source: Genbank
Position: CP000031.2:61973..62371 (+ strand)
Length: 399
gbkey: Gene
gene: mutT
gene_biotype: protein_coding
load_id: gene-SPO0060
locus_tag: SPO0060
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00293; match to protein family HMM TIGR00586
Source: Genbank
Position: CP000031.2:61973..62371 (+ strand)
Length: 399
Dbxref: NCBI_GP:AAV93391.1
IMG: mutT: mutator mutT protein
Note: identified by match to protein family HMM PF00293; match to protein family HMM TIGR00586
RefSeq: SPO_RS00305: mutT: 8-oxo-dGTP diphosphatase MutT
gbkey: CDS
gene: mutT
load_id: cds-AAV93391.1
locus_tag: SPO0060
parent_id: gene-SPO0060
product: mutator mutT protein
protein_id: AAV93391.1
transl_table: 11
translation: MKTVLVSAVALIDVDGRVLLAQRPEGKSMAGLWEFPGGKVEPGETPEVALIRELHEELGI NTWASCLAPLTFASHGYDDFHLLMPLFACRKWEGIPQSREGQALKWVRATELRNYPMPPA DVPLIPILRDWL
>mutT class=Sequence position=CP000031.2:61973..62371 (+ strand)
GTGAAAACCG TCCTTGTTTC CGCCGTCGCG CTGATCGACG TGGATGGCCG GGTGCTGCTG GCGCAGCGCC CGGAAGGCAA
GTCGATGGCG GGCCTGTGGG AGTTTCCCGG CGGCAAGGTC GAACCCGGAG AGACACCCGA AGTGGCGCTG ATTCGCGAGC
TGCACGAGGA GCTGGGGATC AATACCTGGG CCTCGTGCCT GGCGCCACTG ACCTTTGCCA GCCATGGCTA TGACGATTTC
CACCTGCTGA TGCCGCTGTT TGCCTGCCGC AAATGGGAAG GTATCCCGCA ATCTCGCGAA GGTCAGGCGC TGAAATGGGT
GCGTGCCACC GAGTTGCGCA ACTATCCGAT GCCGCCTGCG GATGTTCCGC TGATCCCGAT CCTGCGAGAT TGGCTGTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7