Roseobase: Ruegeria pomeroyi DSS-3

Name: mutT
Type: CDS
Description: identified by match to protein family HMM PF00293; match to protein family HMM TIGR00586; NCBI:NTP pyrophosphohydrolase; IMG:8-oxo-dGTP diphosphatase
Source: GenBank
Position: DSS3:61973..62371 (+ strand)
Length: 399
Dbxref: GI:56694988
  GeneID:3196202
Note: identified by match to protein family HMM PF00293; match to protein family HMM TIGR00586
  NCBI:NTP pyrophosphohydrolase
  IMG:8-oxo-dGTP diphosphatase
codon_start: 1
eC_number: 3.6.1.-
load_id: SPO0060.p01
locus_tag: SPO0060
parent_id: SPO0060.t01
product: mutator mutT protein
protein_id: REF_tigr:SPO0060
  YP_165334.1
transl_table: 11
translation: MKTVLVSAVALIDVDGRVLLAQRPEGKSMAGLWEFPGGKVEPGETPEVALIRELHEELGI NTWASCLAPLTFASHGYDDFHLLMPLFACRKWEGIPQSREGQALKWVRATELRNYPMPPA DVPLIPILRDWL
>mutT class=Sequence position=DSS3:61973..62371 (+ strand)
GTGAAAACCG TCCTTGTTTC CGCCGTCGCG CTGATCGACG TGGATGGCCG GGTGCTGCTG GCGCAGCGCC CGGAAGGCAA
GTCGATGGCG GGCCTGTGGG AGTTTCCCGG CGGCAAGGTC GAACCCGGAG AGACACCCGA AGTGGCGCTG ATTCGCGAGC
TGCACGAGGA GCTGGGGATC AATACCTGGG CCTCGTGCCT GGCGCCACTG ACCTTTGCCA GCCATGGCTA TGACGATTTC
CACCTGCTGA TGCCGCTGTT TGCCTGCCGC AAATGGGAAG GTATCCCGCA ATCTCGCGAA GGTCAGGCGC TGAAATGGGT
GCGTGCCACC GAGTTGCGCA ACTATCCGAT GCCGCCTGCG GATGTTCCGC TGATCCCGAT CCTGCGAGAT TGGCTGTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7