Roseobase: Ruegeria pomeroyi DSS-3

Name: nusA
Type: gene
Description:
Source: GenBank
Position: DSS3:66012..67637 (- strand)
Length: 1626
Dbxref: GeneID:3196304
load_id: SPO0063
locus_tag: SPO0063
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:66012..67637 (- strand)
Length: 1626
load_id: SPO0063.t01
parent_id: SPO0063
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00013; match to protein family HMM TIGR01953; match to protein family HMM TIGR01954; NCBI:transcription termination protein NusA; IMG:NusA antitermination factor
Source: GenBank
Position: DSS3:66012..67637 (- strand)
Length: 1626
Dbxref: GI:56694991
  GeneID:3196304
Note: identified by match to protein family HMM PF00013; match to protein family HMM TIGR01953; match to protein family HMM TIGR01954
  NCBI:transcription termination protein NusA
  IMG:NusA antitermination factor
codon_start: 1
load_id: SPO0063.p01
locus_tag: SPO0063
parent_id: SPO0063.t01
product: transcription termination factor NusA
protein_id: REF_tigr:SPO0063
  YP_165337.1
transl_table: 11
translation: MAITSANQLELLQTAEAVAREKMIDPGLVIEAMEESLARAAKSRYGAEMDIRVSIDRKTG KATFTRVRTVVADEELENYQAEFTVDQAKQYMENPQIGDTFVEEVPPVEMGRIAAQSAKQ VILQKVREAERDRQYEEFKDRAGTIINGLVKREEYGNVIVDVGAGEAILRRNEKIGRESY RPNDRIRCYIKDVRREPRGPQIFLSRTAPEFMAELFKMEVPEIYDGIIEIKAVARDPGSR AKIAVISYDNSIDPVGACVGMRGSRVQAVVNELQGEKIDIIPWNEDQPTFLVNALQPAEV SKVVLDEEAGKIEVVVPEEQLSLAIGRRGQNVRLASQLTGLDIDIMTEAEESARRQKEFE SRTNLFMETLDLDEFFAQLLVSEGFTNLEEVAYVELDELLVIDGVDEGTAEELQARARDY LEAQAKAALDNARALGAEDSLIQFEGLTPQMVEALAKDDVKTLEDFATCADWELAGGWTT VDGQRVKDDGILEPFGVSLEDAQDMVMTARVMLGWVDPTELLEEAEETEEGETATDEEAG A
Type: exon
Description:
Source: GenBank
Position: DSS3:66012..67637 (- strand)
Length: 1626
parent_id: SPO0063.t01
> class=Sequence position=DSS3:66012..67637 (- strand)
ATGGCAATCA CCTCTGCAAA CCAGCTTGAG CTGCTGCAAA CCGCCGAGGC CGTGGCCCGT GAGAAGATGA TCGACCCCGG
GTTGGTGATC GAAGCGATGG AGGAATCCCT CGCCCGCGCG GCCAAGAGCC GCTACGGCGC CGAGATGGAT ATCCGCGTCA
GCATCGACCG CAAGACCGGC AAGGCGACCT TTACCCGCGT CCGTACCGTC GTCGCCGATG AAGAGCTGGA GAATTATCAG
GCCGAGTTCA CCGTCGACCA GGCCAAGCAG TACATGGAAA ACCCGCAGAT CGGCGATACC TTCGTCGAAG AGGTGCCCCC
GGTCGAGATG GGCCGCATCG CCGCGCAATC CGCCAAGCAG GTGATCCTGC AAAAGGTGCG CGAAGCCGAA CGTGACCGCC
AGTACGAAGA GTTCAAGGAC CGCGCCGGCA CCATCATCAA CGGCCTCGTC AAGCGCGAGG AATACGGTAA CGTCATCGTC
GATGTGGGCG CGGGCGAAGC GATCCTGCGT CGCAACGAGA AGATCGGCCG CGAAAGCTAT CGCCCCAACG ACCGTATCCG
CTGCTACATC AAGGATGTGC GCCGCGAGCC GCGCGGGCCG CAGATCTTCC TGTCGCGCAC CGCGCCGGAA TTCATGGCCG
AGCTGTTCAA GATGGAAGTG CCGGAAATCT ATGACGGCAT CATCGAGATC AAGGCCGTGG CCCGCGACCC GGGCAGCCGC
GCCAAGATCG CCGTGATCTC CTATGACAAC TCGATCGACC CGGTCGGCGC CTGCGTCGGT ATGCGCGGCA GCCGTGTGCA
GGCCGTGGTG AACGAGCTTC AGGGCGAAAA GATCGACATC ATCCCGTGGA ACGAGGATCA GCCGACCTTC CTGGTGAACG
CGCTGCAACC GGCCGAAGTG TCCAAGGTTG TGCTGGACGA AGAAGCCGGC AAGATCGAGG TCGTGGTGCC CGAGGAACAG
CTGAGCCTGG CCATCGGCCG TCGCGGCCAG AACGTGCGCC TGGCCAGCCA GCTGACCGGT CTGGACATCG ACATCATGAC
CGAGGCCGAG GAATCGGCGC GCCGTCAGAA GGAATTCGAG AGCCGCACCA ACCTGTTCAT GGAGACCCTG GATCTGGACG
AATTCTTTGC CCAGCTGCTG GTCTCCGAAG GGTTCACCAA TCTCGAAGAG GTCGCCTATG TCGAGCTTGA CGAACTGCTG
GTGATCGACG GGGTCGACGA GGGCACCGCC GAAGAGCTGC AGGCCCGTGC CCGCGATTAT CTCGAGGCAC AGGCCAAGGC
GGCGCTGGAC AATGCCCGCG CGCTGGGCGC CGAGGACAGC CTGATCCAGT TCGAGGGCCT GACGCCCCAG ATGGTCGAGG
CGCTGGCCAA GGACGACGTC AAGACGCTGG AAGATTTCGC AACCTGCGCC GACTGGGAAC TGGCCGGTGG CTGGACCACG
GTCGACGGTC AGCGGGTCAA GGATGACGGC ATTCTGGAGC CCTTCGGCGT TTCGCTGGAA GATGCGCAGG ACATGGTGAT
GACCGCCCGC GTTATGCTGG GCTGGGTCGA TCCGACCGAA CTGCTCGAAG AGGCGGAAGA GACCGAAGAA GGCGAAACCG
CAACCGACGA GGAGGCCGGA GCCTGA
>nusA class=Sequence position=DSS3:66012..67637 (- strand)
ATGGCAATCA CCTCTGCAAA CCAGCTTGAG CTGCTGCAAA CCGCCGAGGC CGTGGCCCGT GAGAAGATGA TCGACCCCGG
GTTGGTGATC GAAGCGATGG AGGAATCCCT CGCCCGCGCG GCCAAGAGCC GCTACGGCGC CGAGATGGAT ATCCGCGTCA
GCATCGACCG CAAGACCGGC AAGGCGACCT TTACCCGCGT CCGTACCGTC GTCGCCGATG AAGAGCTGGA GAATTATCAG
GCCGAGTTCA CCGTCGACCA GGCCAAGCAG TACATGGAAA ACCCGCAGAT CGGCGATACC TTCGTCGAAG AGGTGCCCCC
GGTCGAGATG GGCCGCATCG CCGCGCAATC CGCCAAGCAG GTGATCCTGC AAAAGGTGCG CGAAGCCGAA CGTGACCGCC
AGTACGAAGA GTTCAAGGAC CGCGCCGGCA CCATCATCAA CGGCCTCGTC AAGCGCGAGG AATACGGTAA CGTCATCGTC
GATGTGGGCG CGGGCGAAGC GATCCTGCGT CGCAACGAGA AGATCGGCCG CGAAAGCTAT CGCCCCAACG ACCGTATCCG
CTGCTACATC AAGGATGTGC GCCGCGAGCC GCGCGGGCCG CAGATCTTCC TGTCGCGCAC CGCGCCGGAA TTCATGGCCG
AGCTGTTCAA GATGGAAGTG CCGGAAATCT ATGACGGCAT CATCGAGATC AAGGCCGTGG CCCGCGACCC GGGCAGCCGC
GCCAAGATCG CCGTGATCTC CTATGACAAC TCGATCGACC CGGTCGGCGC CTGCGTCGGT ATGCGCGGCA GCCGTGTGCA
GGCCGTGGTG AACGAGCTTC AGGGCGAAAA GATCGACATC ATCCCGTGGA ACGAGGATCA GCCGACCTTC CTGGTGAACG
CGCTGCAACC GGCCGAAGTG TCCAAGGTTG TGCTGGACGA AGAAGCCGGC AAGATCGAGG TCGTGGTGCC CGAGGAACAG
CTGAGCCTGG CCATCGGCCG TCGCGGCCAG AACGTGCGCC TGGCCAGCCA GCTGACCGGT CTGGACATCG ACATCATGAC
CGAGGCCGAG GAATCGGCGC GCCGTCAGAA GGAATTCGAG AGCCGCACCA ACCTGTTCAT GGAGACCCTG GATCTGGACG
AATTCTTTGC CCAGCTGCTG GTCTCCGAAG GGTTCACCAA TCTCGAAGAG GTCGCCTATG TCGAGCTTGA CGAACTGCTG
GTGATCGACG GGGTCGACGA GGGCACCGCC GAAGAGCTGC AGGCCCGTGC CCGCGATTAT CTCGAGGCAC AGGCCAAGGC
GGCGCTGGAC AATGCCCGCG CGCTGGGCGC CGAGGACAGC CTGATCCAGT TCGAGGGCCT GACGCCCCAG ATGGTCGAGG
CGCTGGCCAA GGACGACGTC AAGACGCTGG AAGATTTCGC AACCTGCGCC GACTGGGAAC TGGCCGGTGG CTGGACCACG
GTCGACGGTC AGCGGGTCAA GGATGACGGC ATTCTGGAGC CCTTCGGCGT TTCGCTGGAA GATGCGCAGG ACATGGTGAT
GACCGCCCGC GTTATGCTGG GCTGGGTCGA TCCGACCGAA CTGCTCGAAG AGGCGGAAGA GACCGAAGAA GGCGAAACCG
CAACCGACGA GGAGGCCGGA GCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7