Roseobase: Ruegeria pomeroyi DSS-3

Name: panC
Type: CDS
Description: identified by similarity to SP:P31663; match to protein family HMM PF02569; match to protein family HMM TIGR00018; match to protein family HMM TIGR00125
Source: Genbank
Position: CP000031.2:105716..106573 (+ strand)
Length: 858
Dbxref: NCBI_GP:AAV93434.1
IMG: panC: pantothenate synthetase (EC 6.3.2.1)
Note: identified by similarity to SP:P31663; match to protein family HMM PF02569; match to protein family HMM TIGR00018; match to protein family HMM TIGR00125
RefSeq: SPO_RS00520: pantoate--beta-alanine ligase
gbkey: CDS
gene: panC
load_id: cds-AAV93434.1
locus_tag: SPO0103
parent_id: gene-SPO0103
product: pantoate--beta-alanine ligase
protein_id: AAV93434.1
transl_table: 11
translation: MSAPILRKLADLRAATAGWKRAGESIGVVPTMGALHDGHLSLVAAAKAGCDRVVVTIFVN PKQFNNPEDLAKYPRTELADASKLAPYGVDAIYVPDPDQIYPEGFATTVSVSGLTDVMEG ACRPGHFDGVATVVAKLFLQTGADQAYFGEKDYQQMMLVTRMAQDLDIPITVVGCPTVRE ASGLAMSSRNMRLSAEGLERAGRLHPVMRQVAERLAAGASFGDLAPGAREALGAAGFVDI EYFDLRAADSLRALDRPTEPARLLVAAWLDGVRLIDNIAVSQLND
>panC class=Sequence position=CP000031.2:105716..106573 (+ strand)
ATGAGCGCGC CGATCCTGCG CAAGCTGGCC GATCTGCGCG CCGCCACCGC CGGCTGGAAG CGCGCGGGCG AGAGCATCGG
CGTGGTGCCC ACGATGGGCG CGCTGCATGA CGGGCACCTG TCGCTGGTCG CGGCGGCCAA GGCGGGCTGC GACCGAGTGG
TGGTGACCAT TTTCGTCAAC CCGAAACAGT TCAACAACCC CGAAGATCTG GCCAAGTATC CCCGCACCGA ACTGGCCGAC
GCGTCCAAGC TGGCGCCCTA TGGGGTCGAT GCGATCTATG TGCCCGATCC TGACCAGATC TATCCCGAGG GGTTTGCGAC
CACCGTTTCG GTCTCGGGCC TGACCGACGT GATGGAGGGC GCGTGCCGCC CTGGTCATTT CGACGGCGTG GCAACCGTGG
TGGCCAAACT GTTCCTGCAA ACCGGGGCCG ATCAGGCCTA TTTCGGCGAA AAGGACTATC AGCAGATGAT GCTGGTGACC
CGCATGGCGC AGGATCTGGA TATCCCGATC ACCGTGGTGG GGTGCCCCAC GGTGCGCGAG GCCTCGGGCC TTGCGATGTC
GTCGCGCAAC ATGCGGCTGT CGGCTGAGGG GCTGGAGCGG GCCGGTCGGC TGCATCCCGT CATGCGGCAG GTGGCCGAGC
GGCTGGCGGC TGGCGCCTCT TTTGGTGATC TGGCGCCCGG GGCGCGCGAG GCGCTGGGCG CCGCCGGTTT TGTCGATATC
GAGTACTTCG ATCTGCGCGC GGCGGACAGC CTGCGCGCAC TCGACCGTCC CACCGAACCC GCGCGCCTGT TGGTGGCGGC
CTGGCTCGAC GGGGTTCGGC TGATCGACAA TATCGCGGTT TCCCAACTAA ACGATTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7