Roseobase: Ruegeria pomeroyi DSS-3

Name: parA
Type: CDS
Description: identified by similarity to SP:O05189; match to protein family HMM PF01656
Source: Genbank
Position: CP000031.2:2473..3276 (+ strand)
Length: 804
Dbxref: NCBI_GP:AAV93334.1
IMG: parA: chromosome partitioning protein ParA
Note: identified by similarity to SP:O05189; match to protein family HMM PF01656
RefSeq: SPO_RS00015: AAA family ATPase
gbkey: CDS
gene: parA
load_id: cds-AAV93334.1
locus_tag: SPO0003
parent_id: gene-SPO0003
product: chromosome partitioning protein ParA
protein_id: AAV93334.1
transl_table: 11
translation: MSDLSRPAGPRIIAVANQKGGVGKTTTAINLAAALVESGQRVLVVDLDPQGNASTGLGVD ERELTTYELLVDDAPLNSVIQKTSIDGLSIVPATVDLSSADIELISNEKRSFLLHDALRQ TAMDAYSWDYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREVRQA ANPNLRIEGIVLTMYDRRNNLSQQVEKDARDNLGDLVFETKIPRNVRVSEAPSFAMPVLN YDPNSLGAMAYRDLAAELMKKHNKIAA
>parA class=Sequence position=CP000031.2:2473..3276 (+ strand)
GTGTCTGATC TTTCCCGTCC TGCCGGACCC CGGATCATTG CGGTCGCCAA CCAGAAGGGC GGCGTGGGAA AGACCACAAC
TGCCATCAAC CTCGCCGCAG CATTGGTGGA ATCCGGCCAG CGTGTGCTGG TTGTGGATCT TGACCCGCAA GGGAATGCCT
CGACCGGGTT GGGTGTGGAT GAACGAGAAT TGACGACCTA TGAACTGTTG GTTGATGACG CGCCGTTGAA TTCGGTGATC
CAGAAAACCA GCATCGACGG CCTGTCGATC GTGCCGGCCA CGGTCGATCT GAGTTCGGCG GATATCGAGC TGATTTCGAA
TGAAAAGCGC AGTTTCCTGC TGCATGACGC CCTGCGGCAG ACGGCGATGG ATGCCTATTC TTGGGACTAT ATCCTGATCG
ACTGCCCGCC CTCGCTGAAC CTGTTGACGG TCAACGCCAT GGTTGCCGCG CATTCAGTTC TTGTGCCGTT GCAAAGCGAG
TTCTTTGCGC TCGAAGGCCT GTCCCAGCTG ATGCTGACCA TCCGCGAGGT GCGACAGGCA GCAAACCCCA ATCTGCGGAT
CGAGGGGATT GTATTGACCA TGTATGACCG ACGCAACAAC CTGTCGCAGC AGGTCGAGAA GGACGCGCGC GACAATCTGG
GTGATCTGGT ATTCGAAACC AAGATCCCCC GCAATGTGCG GGTCAGCGAG GCACCGTCTT TTGCCATGCC GGTGCTCAAC
TACGATCCGA ACTCTCTGGG TGCGATGGCC TATCGTGACC TGGCCGCGGA ACTGATGAAG AAACATAACA AGATCGCCGC
CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7