Roseobase: Ruegeria pomeroyi DSS-3

Name: parB
Type: gene
Description:
Source: GenBank
Position: DSS3:3299..4189 (+ strand)
Length: 891
Dbxref: GeneID:3192954
load_id: SPO0004
locus_tag: SPO0004
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:3299..4189 (+ strand)
Length: 891
load_id: SPO0004.t01
parent_id: SPO0004
Parts:
Type: CDS
Description: identified by similarity to SP:O05190; match to protein family HMM PF02195; match to protein family HMM TIGR00180; NCBI:chromosome partitioning protein ParB; IMG:chromosome segregation DNA-binding protein
Source: GenBank
Position: DSS3:3299..4189 (+ strand)
Length: 891
Dbxref: GI:56694932
  GeneID:3192954
Note: identified by similarity to SP:O05190; match to protein family HMM PF02195; match to protein family HMM TIGR00180
  NCBI:chromosome partitioning protein ParB
  IMG:chromosome segregation DNA-binding protein
codon_start: 1
load_id: SPO0004.p01
locus_tag: SPO0004
parent_id: SPO0004.t01
product: chromosome partitioning protein parB
protein_id: REF_tigr:SPO0004
  YP_165277.1
transl_table: 11
translation: MVSNKPRGLGRGLSALMADVTQPAEAAASEAARRPDRTVPIEKLRANPNQPRRTFTEDAL QELAASIKEKGVLQPLIVRPVDGDMYEIVAGERRWRAAQLAQLHQVPVLVRELDDTEVLE IAIIENIQRADLNAVEEAAGYRQLMDKFGHTQEKLAEALGKSRSHIANLLRLLSLPDDVQ TLVVEGKLSAGHARALITSDNPSELAKIVVRDGLSVRATEALVKKQAEGDKPTATARPKS ITADKDADTRALEKDLSAILAMKVAINHKPGTETGQVVLTYENLDQLDDLCAKLSR
Type: exon
Description:
Source: GenBank
Position: DSS3:3299..4189 (+ strand)
Length: 891
parent_id: SPO0004.t01
> class=Sequence position=DSS3:3299..4189 (+ strand)
ATGGTTTCGA ACAAGCCCCG GGGATTGGGA CGCGGATTGT CCGCGTTGAT GGCCGATGTG ACGCAGCCGG CCGAGGCCGC
CGCTAGCGAG GCAGCGCGTC GTCCGGACCG CACCGTTCCG ATCGAGAAAC TGCGTGCCAA CCCCAACCAG CCTCGCCGCA
CCTTTACCGA GGACGCGTTG CAAGAGCTTG CCGCTTCGAT CAAGGAAAAG GGGGTTCTGC AGCCCTTGAT CGTGCGTCCC
GTTGATGGCG ATATGTACGA GATCGTTGCG GGAGAACGTC GCTGGCGCGC GGCGCAGCTG GCGCAACTGC ATCAGGTGCC
TGTTTTGGTC CGCGAGCTCG ACGATACCGA AGTCCTGGAA ATCGCGATCA TCGAGAACAT TCAGCGCGCT GATCTGAACG
CGGTGGAAGA GGCGGCGGGC TATCGCCAGC TGATGGACAA GTTTGGCCAC ACCCAGGAAA AGCTGGCCGA AGCTCTGGGC
AAAAGCCGAA GCCATATCGC AAACTTGCTG CGACTTCTGT CGTTGCCTGA CGACGTTCAG ACACTTGTTG TCGAGGGGAA
ATTGTCCGCG GGCCATGCGC GCGCCCTCAT CACCAGCGAC AACCCGTCAG AACTGGCCAA GATCGTCGTG CGGGACGGGC
TGTCGGTGCG CGCGACCGAA GCGCTGGTCA AGAAGCAGGC CGAAGGGGAC AAGCCGACCG CGACGGCGCG TCCGAAATCC
ATCACTGCGG ACAAAGACGC CGATACCCGG GCGCTGGAAA AGGATCTGTC GGCCATTCTG GCGATGAAGG TAGCGATCAA
TCACAAGCCG GGAACGGAAA CCGGGCAGGT GGTGCTGACC TATGAGAACC TCGATCAGCT TGATGATCTT TGTGCAAAAC
TCAGCCGTTA G
>parB class=Sequence position=DSS3:3299..4189 (+ strand)
ATGGTTTCGA ACAAGCCCCG GGGATTGGGA CGCGGATTGT CCGCGTTGAT GGCCGATGTG ACGCAGCCGG CCGAGGCCGC
CGCTAGCGAG GCAGCGCGTC GTCCGGACCG CACCGTTCCG ATCGAGAAAC TGCGTGCCAA CCCCAACCAG CCTCGCCGCA
CCTTTACCGA GGACGCGTTG CAAGAGCTTG CCGCTTCGAT CAAGGAAAAG GGGGTTCTGC AGCCCTTGAT CGTGCGTCCC
GTTGATGGCG ATATGTACGA GATCGTTGCG GGAGAACGTC GCTGGCGCGC GGCGCAGCTG GCGCAACTGC ATCAGGTGCC
TGTTTTGGTC CGCGAGCTCG ACGATACCGA AGTCCTGGAA ATCGCGATCA TCGAGAACAT TCAGCGCGCT GATCTGAACG
CGGTGGAAGA GGCGGCGGGC TATCGCCAGC TGATGGACAA GTTTGGCCAC ACCCAGGAAA AGCTGGCCGA AGCTCTGGGC
AAAAGCCGAA GCCATATCGC AAACTTGCTG CGACTTCTGT CGTTGCCTGA CGACGTTCAG ACACTTGTTG TCGAGGGGAA
ATTGTCCGCG GGCCATGCGC GCGCCCTCAT CACCAGCGAC AACCCGTCAG AACTGGCCAA GATCGTCGTG CGGGACGGGC
TGTCGGTGCG CGCGACCGAA GCGCTGGTCA AGAAGCAGGC CGAAGGGGAC AAGCCGACCG CGACGGCGCG TCCGAAATCC
ATCACTGCGG ACAAAGACGC CGATACCCGG GCGCTGGAAA AGGATCTGTC GGCCATTCTG GCGATGAAGG TAGCGATCAA
TCACAAGCCG GGAACGGAAA CCGGGCAGGT GGTGCTGACC TATGAGAACC TCGATCAGCT TGATGATCTT TGTGCAAAAC
TCAGCCGTTA G

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7