Roseobase: Ruegeria pomeroyi DSS-3

Name: pip
Type: CDS
Description: identified by match to protein family HMM PF00561; match to protein family HMM TIGR01249
Source: Genbank
Position: CP000031.2:69238..70188 (- strand)
Length: 951
Dbxref: NCBI_GP:AAV93397.1
IMG: pip: proline iminopeptidase
Note: identified by match to protein family HMM PF00561; match to protein family HMM TIGR01249
RefSeq: SPO_RS00335: pip: prolyl aminopeptidase
gbkey: CDS
gene: pip
load_id: cds-AAV93397.1
locus_tag: SPO0066
parent_id: gene-SPO0066
product: proline iminopeptidase
protein_id: AAV93397.1
transl_table: 11
translation: MQYLHPPIEPFDQRMLDVGQGHRIYVEQSGNPNGIPVVVLHGGPGGGCSPAMRRYFDPSV YRVILFDQRGCGRSRPHASVTDNTTWHLVADIERIRKTLEIDSWIAFGGSWGATLALIYA QTHPDRVTHLVLRGVFLMTQAELDWFYGGGAGRFWPEPWSRFAALIPENERGDMIAAYHK RLFSGDMAQEIRYARAWSAWENALASIQSNGTTGESPGDYARAFARLENHYFINDGFLEF DGQILANMGRISHIPGHIVQGRYDMICPPNSAWKLSELWPNADLRMIRNAGHALSEPGIS AELVRIMDAIAEEVTA
>pip class=Sequence position=CP000031.2:69238..70188 (- strand)
GTGCAATATC TTCACCCGCC GATCGAGCCG TTCGATCAGC GGATGCTGGA TGTCGGCCAG GGCCACCGCA TCTATGTCGA
GCAAAGCGGC AATCCAAACG GCATCCCTGT CGTGGTGCTG CATGGCGGCC CGGGTGGCGG CTGTAGCCCG GCGATGCGGC
GCTATTTCGA TCCGTCCGTC TACCGGGTGA TTCTCTTCGA TCAGCGCGGC TGTGGCCGGT CTCGGCCGCA TGCCTCGGTC
ACCGACAACA CCACCTGGCA TCTGGTCGCC GATATCGAGC GTATCCGCAA GACGCTGGAA ATCGACAGCT GGATCGCCTT
TGGCGGCAGC TGGGGCGCAA CGCTGGCGCT GATCTATGCC CAGACCCATC CCGACCGCGT TACCCATCTG GTGCTGCGCG
GTGTGTTTCT GATGACCCAG GCCGAGCTTG ACTGGTTCTA TGGCGGCGGT GCCGGGCGGT TCTGGCCGGA ACCCTGGTCG
CGCTTTGCCG CGCTGATCCC CGAGAATGAA CGCGGCGACA TGATCGCGGC CTATCACAAG CGCCTGTTCT CGGGCGATAT
GGCGCAGGAG ATCCGCTATG CCCGCGCCTG GTCAGCCTGG GAAAACGCGC TCGCCTCGAT CCAGTCCAAC GGCACCACCG
GCGAAAGCCC CGGTGATTAT GCCCGCGCCT TTGCCCGGCT CGAGAATCAC TATTTCATCA ATGACGGCTT CCTGGAATTC
GACGGCCAGA TCCTCGCCAA CATGGGGCGC ATCTCGCATA TTCCCGGCCA TATCGTGCAG GGGCGCTATG ACATGATCTG
CCCGCCCAAC TCGGCCTGGA AGCTCAGCGA GCTTTGGCCG AATGCCGACC TGCGGATGAT CCGCAACGCC GGCCACGCCC
TGTCCGAACC GGGAATCAGC GCCGAACTGG TGCGCATCAT GGACGCCATC GCCGAGGAGG TCACCGCATG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7