Roseobase: Ruegeria pomeroyi DSS-3

Name: pip
Type: CDS
Description: identified by match to protein family HMM PF00561; match to protein family HMM TIGR01249; NCBI:prolyl aminopeptidase; IMG:proline iminopeptidase
Source: GenBank
Position: DSS3:69238..70188 (- strand)
Length: 951
Dbxref: GI:56694994
  GeneID:3193990
Note: identified by match to protein family HMM PF00561; match to protein family HMM TIGR01249
  NCBI:prolyl aminopeptidase
  IMG:proline iminopeptidase
codon_start: 1
eC_number: 3.4.11.5
load_id: SPO0066.p01
locus_tag: SPO0066
parent_id: SPO0066.t01
product: proline iminopeptidase
protein_id: REF_tigr:SPO0066
  YP_165340.1
transl_table: 11
translation: MQYLHPPIEPFDQRMLDVGQGHRIYVEQSGNPNGIPVVVLHGGPGGGCSPAMRRYFDPSV YRVILFDQRGCGRSRPHASVTDNTTWHLVADIERIRKTLEIDSWIAFGGSWGATLALIYA QTHPDRVTHLVLRGVFLMTQAELDWFYGGGAGRFWPEPWSRFAALIPENERGDMIAAYHK RLFSGDMAQEIRYARAWSAWENALASIQSNGTTGESPGDYARAFARLENHYFINDGFLEF DGQILANMGRISHIPGHIVQGRYDMICPPNSAWKLSELWPNADLRMIRNAGHALSEPGIS AELVRIMDAIAEEVTA
>pip class=Sequence position=DSS3:69238..70188 (- strand)
GTGCAATATC TTCACCCGCC GATCGAGCCG TTCGATCAGC GGATGCTGGA TGTCGGCCAG GGCCACCGCA TCTATGTCGA
GCAAAGCGGC AATCCAAACG GCATCCCTGT CGTGGTGCTG CATGGCGGCC CGGGTGGCGG CTGTAGCCCG GCGATGCGGC
GCTATTTCGA TCCGTCCGTC TACCGGGTGA TTCTCTTCGA TCAGCGCGGC TGTGGCCGGT CTCGGCCGCA TGCCTCGGTC
ACCGACAACA CCACCTGGCA TCTGGTCGCC GATATCGAGC GTATCCGCAA GACGCTGGAA ATCGACAGCT GGATCGCCTT
TGGCGGCAGC TGGGGCGCAA CGCTGGCGCT GATCTATGCC CAGACCCATC CCGACCGCGT TACCCATCTG GTGCTGCGCG
GTGTGTTTCT GATGACCCAG GCCGAGCTTG ACTGGTTCTA TGGCGGCGGT GCCGGGCGGT TCTGGCCGGA ACCCTGGTCG
CGCTTTGCCG CGCTGATCCC CGAGAATGAA CGCGGCGACA TGATCGCGGC CTATCACAAG CGCCTGTTCT CGGGCGATAT
GGCGCAGGAG ATCCGCTATG CCCGCGCCTG GTCAGCCTGG GAAAACGCGC TCGCCTCGAT CCAGTCCAAC GGCACCACCG
GCGAAAGCCC CGGTGATTAT GCCCGCGCCT TTGCCCGGCT CGAGAATCAC TATTTCATCA ATGACGGCTT CCTGGAATTC
GACGGCCAGA TCCTCGCCAA CATGGGGCGC ATCTCGCATA TTCCCGGCCA TATCGTGCAG GGGCGCTATG ACATGATCTG
CCCGCCCAAC TCGGCCTGGA AGCTCAGCGA GCTTTGGCCG AATGCCGACC TGCGGATGAT CCGCAACGCC GGCCACGCCC
TGTCCGAACC GGGAATCAGC GCCGAACTGG TGCGCATCAT GGACGCCATC GCCGAGGAGG TCACCGCATG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7