Roseobase: Ruegeria pomeroyi DSS-3

Name: pncA
Type: CDS
Description: identified by similarity to SP:P21369; match to protein family HMM PF00857
Source: Genbank
Position: CP000031.2:92595..93185 (+ strand)
Length: 591
Dbxref: NCBI_GP:AAV93423.1
IMG: pncA: pyrazinamidase/nicotinamidase
Note: identified by similarity to SP:P21369; match to protein family HMM PF00857
RefSeq: SPO_RS00470: pncA: bifunctional nicotinamidase/pyrazinamidase
gbkey: CDS
gene: pncA
load_id: cds-AAV93423.1
locus_tag: SPO0093
parent_id: gene-SPO0093
product: pyrazinamidase/nicotinamidase
protein_id: AAV93423.1
transl_table: 11
translation: MHGLIVIDVQNDFCPGGALAVPEGDAVVAPINAMMKDFDAVVLTQDWHPAGHSSFASSHP GQAPFEMIEMAYGPQVLWPDHCVQGSPGAAFHPALRTDADLILRKGFRAAIDSYSGFFEN DRSTPTGLEGYLRSRGITRLTLAGLATDFCVQYSALDAARLGFAVEVRMQACRAIDLDGS LAAAIAAMKAGGIALT
>pncA class=Sequence position=CP000031.2:92595..93185 (+ strand)
ATGCATGGCC TGATCGTGAT CGACGTCCAG AACGACTTCT GCCCCGGCGG TGCCCTGGCG GTGCCCGAAG GCGACGCGGT
GGTGGCGCCG ATCAACGCCA TGATGAAGGA TTTCGACGCG GTGGTCCTGA CGCAGGATTG GCACCCGGCG GGGCATTCCT
CTTTCGCTTC GTCCCATCCG GGCCAAGCAC CGTTCGAGAT GATCGAGATG GCCTATGGGC CGCAGGTGTT GTGGCCCGAC
CATTGCGTGC AGGGCAGCCC CGGCGCTGCG TTTCACCCGG CGCTGCGGAC CGATGCCGAT TTGATCCTGC GCAAGGGGTT
CCGCGCCGCG ATCGACAGCT ATTCGGGCTT CTTCGAAAAC GACCGCAGCA CGCCCACCGG CCTCGAGGGC TATTTGCGCA
GCCGGGGCAT CACCCGACTG ACGCTGGCCG GACTCGCCAC CGATTTCTGC GTGCAGTATT CGGCGCTGGA TGCGGCGCGG
CTGGGCTTTG CCGTCGAGGT GCGGATGCAG GCCTGTCGCG CCATCGATCT GGACGGGTCG CTGGCGGCGG CGATTGCCGC
GATGAAGGCG GGCGGGATTG CTCTGACCTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7