Roseobase: Ruegeria pomeroyi DSS-3

Name: pncB
Type: gene
Description:
Source: Genbank
Position: CP000031.2:95526..96869 (+ strand)
Length: 1344
gbkey: Gene
gene: pncB
gene_biotype: protein_coding
load_id: gene-SPO0095
locus_tag: SPO0095
Parts:
Type: CDS
Description: identified by similarity to SP:P18133; match to protein family HMM PF04095
Source: Genbank
Position: CP000031.2:95526..96869 (+ strand)
Length: 1344
Dbxref: NCBI_GP:AAV93426.1
IMG: pncB: nicotinate phosphoribosyltransferase
Note: identified by similarity to SP:P18133; match to protein family HMM PF04095
RefSeq: SPO_RS00480: pncB: nicotinate phosphoribosyltransferase
gbkey: CDS
gene: pncB
load_id: cds-AAV93426.1
locus_tag: SPO0095
parent_id: gene-SPO0095
product: nicotinate phosphoribosyltransferase
protein_id: AAV93426.1
transl_table: 11
translation: MAVRLAYPWVIHSERGPSVDIATRVYNHKWKIDPIVRSLIDTDFYKLLMCQSVFRNKPDT QVTFSLINRTMRIPLARIIDEGELREQLDHIRSLRLSRGESTWLRGNTFYGKRQMFRPDF MEWFEGLQLPPYHLERRDDQYELTFEGNWPEVMLWEIPALAVLMELRSRAVLHDMRRFEL QVLYARAMTRVWEKIERLRGIDGLTIADFGTRRRHSFLWQDWCVQAMIEGLGAKFTGTSN CLIAMRREVEAIGTNAHELPMVYSALAETDTELARAPYDVLSDWHEEHDGNLRIILPDTY GTKGFLDRAPDWLAGWTGIRIDSGDPAEGAETAISWWKDRGENPTDKRIIFSDGLDVDKI AELHARFSGRAKISFGWGTLLTNDFRGLVPDDGLAPFSLVCKAVSANGHPTVKLSDNPEK AMGPADEVARYKRVFGVGRQTSYAVEV
>pncB class=Sequence position=CP000031.2:95526..96869 (+ strand)
ATGGCGGTTC GGCTGGCGTA TCCATGGGTG ATCCATTCCG AACGAGGGCC ATCCGTGGAC ATCGCAACCC GCGTCTATAA
TCACAAGTGG AAGATCGACC CGATCGTCCG GTCGCTGATT GATACCGATT TCTACAAGTT GCTGATGTGC CAATCGGTGT
TCCGCAACAA GCCCGACACT CAGGTCACCT TTTCCCTGAT CAACCGCACG ATGCGGATCC CGTTGGCCCG TATCATTGAC
GAGGGCGAGT TGCGCGAGCA GCTCGATCAT ATCCGCTCGC TGCGGCTGAG CCGGGGCGAG AGCACCTGGT TGCGTGGCAA
TACCTTTTAC GGCAAGCGGC AGATGTTTAG GCCGGACTTC ATGGAATGGT TCGAGGGGCT GCAGTTGCCG CCCTATCATC
TGGAACGCCG CGACGATCAA TATGAGCTGA CCTTCGAGGG CAACTGGCCC GAGGTGATGC TGTGGGAGAT ACCGGCGCTG
GCAGTGCTGA TGGAACTGCG CTCGCGCGCG GTGCTGCATG ACATGCGCCG GTTCGAGCTG CAGGTGCTTT ATGCCCGCGC
GATGACCCGG GTCTGGGAGA AGATCGAACG CCTGCGCGGG ATCGACGGGC TGACCATCGC CGATTTCGGC ACCCGGCGGC
GGCACTCCTT CCTCTGGCAG GACTGGTGCG TGCAGGCGAT GATCGAGGGG CTGGGCGCGA AATTCACCGG CACCTCCAAC
TGTCTGATCG CGATGCGTCG CGAGGTCGAG GCGATCGGCA CCAATGCGCA TGAACTACCG ATGGTCTATA GCGCCCTGGC
CGAGACCGAC ACCGAACTGG CGCGCGCGCC CTACGACGTG CTGAGCGATT GGCACGAGGA GCATGACGGC AACCTGCGCA
TCATCCTGCC CGATACCTAT GGCACCAAGG GGTTCCTCGA CCGGGCGCCG GACTGGCTGG CAGGCTGGAC AGGCATCCGG
ATCGACAGTG GCGATCCGGC CGAGGGGGCG GAAACCGCCA TCTCCTGGTG GAAGGATCGC GGCGAGAACC CGACCGACAA
GCGTATCATC TTCTCGGACG GGCTCGACGT GGACAAGATC GCCGAACTGC ATGCCCGGTT TTCCGGGCGG GCCAAGATTT
CCTTCGGCTG GGGCACCCTG CTGACCAATG ATTTCAGGGG CCTCGTGCCG GACGATGGGC TGGCGCCGTT CTCGCTGGTG
TGCAAGGCGG TCTCGGCCAA TGGGCACCCG ACGGTGAAAC TGAGCGACAA TCCGGAAAAG GCGATGGGTC CCGCCGACGA
GGTCGCGCGC TACAAGCGGG TGTTCGGAGT GGGGCGGCAA ACCAGCTATG CGGTCGAGGT GTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7