Roseobase: Ruegeria pomeroyi DSS-3

Name: pncB
Type: gene
Description:
Source: GenBank
Position: DSS3:95526..96869 (+ strand)
Length: 1344
Dbxref: GeneID:3194607
load_id: SPO0095
locus_tag: SPO0095
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:95526..96869 (+ strand)
Length: 1344
load_id: SPO0095.t01
parent_id: SPO0095
Parts:
Type: CDS
Description: identified by similarity to SP:P18133; match to protein family HMM PF04095; NCBI:nicotinate phosphoribosyltransferase; IMG:nicotinate phosphoribosyltransferase
Source: GenBank
Position: DSS3:95526..96869 (+ strand)
Length: 1344
Dbxref: GI:56695023
  GeneID:3194607
Note: identified by similarity to SP:P18133; match to protein family HMM PF04095
  NCBI:nicotinate phosphoribosyltransferase
  IMG:nicotinate phosphoribosyltransferase
codon_start: 1
eC_number: 2.4.2.11
load_id: SPO0095.p01
locus_tag: SPO0095
parent_id: SPO0095.t01
product: nicotinate phosphoribosyltransferase
protein_id: REF_tigr:SPO0095
  YP_165369.1
transl_table: 11
translation: MAVRLAYPWVIHSERGPSVDIATRVYNHKWKIDPIVRSLIDTDFYKLLMCQSVFRNKPDT QVTFSLINRTMRIPLARIIDEGELREQLDHIRSLRLSRGESTWLRGNTFYGKRQMFRPDF MEWFEGLQLPPYHLERRDDQYELTFEGNWPEVMLWEIPALAVLMELRSRAVLHDMRRFEL QVLYARAMTRVWEKIERLRGIDGLTIADFGTRRRHSFLWQDWCVQAMIEGLGAKFTGTSN CLIAMRREVEAIGTNAHELPMVYSALAETDTELARAPYDVLSDWHEEHDGNLRIILPDTY GTKGFLDRAPDWLAGWTGIRIDSGDPAEGAETAISWWKDRGENPTDKRIIFSDGLDVDKI AELHARFSGRAKISFGWGTLLTNDFRGLVPDDGLAPFSLVCKAVSANGHPTVKLSDNPEK AMGPADEVARYKRVFGVGRQTSYAVEV
Type: exon
Description:
Source: GenBank
Position: DSS3:95526..96869 (+ strand)
Length: 1344
parent_id: SPO0095.t01
> class=Sequence position=DSS3:95526..96869 (+ strand)
ATGGCGGTTC GGCTGGCGTA TCCATGGGTG ATCCATTCCG AACGAGGGCC ATCCGTGGAC ATCGCAACCC GCGTCTATAA
TCACAAGTGG AAGATCGACC CGATCGTCCG GTCGCTGATT GATACCGATT TCTACAAGTT GCTGATGTGC CAATCGGTGT
TCCGCAACAA GCCCGACACT CAGGTCACCT TTTCCCTGAT CAACCGCACG ATGCGGATCC CGTTGGCCCG TATCATTGAC
GAGGGCGAGT TGCGCGAGCA GCTCGATCAT ATCCGCTCGC TGCGGCTGAG CCGGGGCGAG AGCACCTGGT TGCGTGGCAA
TACCTTTTAC GGCAAGCGGC AGATGTTTAG GCCGGACTTC ATGGAATGGT TCGAGGGGCT GCAGTTGCCG CCCTATCATC
TGGAACGCCG CGACGATCAA TATGAGCTGA CCTTCGAGGG CAACTGGCCC GAGGTGATGC TGTGGGAGAT ACCGGCGCTG
GCAGTGCTGA TGGAACTGCG CTCGCGCGCG GTGCTGCATG ACATGCGCCG GTTCGAGCTG CAGGTGCTTT ATGCCCGCGC
GATGACCCGG GTCTGGGAGA AGATCGAACG CCTGCGCGGG ATCGACGGGC TGACCATCGC CGATTTCGGC ACCCGGCGGC
GGCACTCCTT CCTCTGGCAG GACTGGTGCG TGCAGGCGAT GATCGAGGGG CTGGGCGCGA AATTCACCGG CACCTCCAAC
TGTCTGATCG CGATGCGTCG CGAGGTCGAG GCGATCGGCA CCAATGCGCA TGAACTACCG ATGGTCTATA GCGCCCTGGC
CGAGACCGAC ACCGAACTGG CGCGCGCGCC CTACGACGTG CTGAGCGATT GGCACGAGGA GCATGACGGC AACCTGCGCA
TCATCCTGCC CGATACCTAT GGCACCAAGG GGTTCCTCGA CCGGGCGCCG GACTGGCTGG CAGGCTGGAC AGGCATCCGG
ATCGACAGTG GCGATCCGGC CGAGGGGGCG GAAACCGCCA TCTCCTGGTG GAAGGATCGC GGCGAGAACC CGACCGACAA
GCGTATCATC TTCTCGGACG GGCTCGACGT GGACAAGATC GCCGAACTGC ATGCCCGGTT TTCCGGGCGG GCCAAGATTT
CCTTCGGCTG GGGCACCCTG CTGACCAATG ATTTCAGGGG CCTCGTGCCG GACGATGGGC TGGCGCCGTT CTCGCTGGTG
TGCAAGGCGG TCTCGGCCAA TGGGCACCCG ACGGTGAAAC TGAGCGACAA TCCGGAAAAG GCGATGGGTC CCGCCGACGA
GGTCGCGCGC TACAAGCGGG TGTTCGGAGT GGGGCGGCAA ACCAGCTATG CGGTCGAGGT GTAA
>pncB class=Sequence position=DSS3:95526..96869 (+ strand)
ATGGCGGTTC GGCTGGCGTA TCCATGGGTG ATCCATTCCG AACGAGGGCC ATCCGTGGAC ATCGCAACCC GCGTCTATAA
TCACAAGTGG AAGATCGACC CGATCGTCCG GTCGCTGATT GATACCGATT TCTACAAGTT GCTGATGTGC CAATCGGTGT
TCCGCAACAA GCCCGACACT CAGGTCACCT TTTCCCTGAT CAACCGCACG ATGCGGATCC CGTTGGCCCG TATCATTGAC
GAGGGCGAGT TGCGCGAGCA GCTCGATCAT ATCCGCTCGC TGCGGCTGAG CCGGGGCGAG AGCACCTGGT TGCGTGGCAA
TACCTTTTAC GGCAAGCGGC AGATGTTTAG GCCGGACTTC ATGGAATGGT TCGAGGGGCT GCAGTTGCCG CCCTATCATC
TGGAACGCCG CGACGATCAA TATGAGCTGA CCTTCGAGGG CAACTGGCCC GAGGTGATGC TGTGGGAGAT ACCGGCGCTG
GCAGTGCTGA TGGAACTGCG CTCGCGCGCG GTGCTGCATG ACATGCGCCG GTTCGAGCTG CAGGTGCTTT ATGCCCGCGC
GATGACCCGG GTCTGGGAGA AGATCGAACG CCTGCGCGGG ATCGACGGGC TGACCATCGC CGATTTCGGC ACCCGGCGGC
GGCACTCCTT CCTCTGGCAG GACTGGTGCG TGCAGGCGAT GATCGAGGGG CTGGGCGCGA AATTCACCGG CACCTCCAAC
TGTCTGATCG CGATGCGTCG CGAGGTCGAG GCGATCGGCA CCAATGCGCA TGAACTACCG ATGGTCTATA GCGCCCTGGC
CGAGACCGAC ACCGAACTGG CGCGCGCGCC CTACGACGTG CTGAGCGATT GGCACGAGGA GCATGACGGC AACCTGCGCA
TCATCCTGCC CGATACCTAT GGCACCAAGG GGTTCCTCGA CCGGGCGCCG GACTGGCTGG CAGGCTGGAC AGGCATCCGG
ATCGACAGTG GCGATCCGGC CGAGGGGGCG GAAACCGCCA TCTCCTGGTG GAAGGATCGC GGCGAGAACC CGACCGACAA
GCGTATCATC TTCTCGGACG GGCTCGACGT GGACAAGATC GCCGAACTGC ATGCCCGGTT TTCCGGGCGG GCCAAGATTT
CCTTCGGCTG GGGCACCCTG CTGACCAATG ATTTCAGGGG CCTCGTGCCG GACGATGGGC TGGCGCCGTT CTCGCTGGTG
TGCAAGGCGG TCTCGGCCAA TGGGCACCCG ACGGTGAAAC TGAGCGACAA TCCGGAAAAG GCGATGGGTC CCGCCGACGA
GGTCGCGCGC TACAAGCGGG TGTTCGGAGT GGGGCGGCAA ACCAGCTATG CGGTCGAGGT GTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7