Roseobase: Ruegeria pomeroyi DSS-3

Name: ptsN
Type: gene
Description:
Source: Genbank
Position: CP000031.2:77195..77659 (- strand)
Length: 465
gbkey: Gene
gene: ptsN
gene_biotype: protein_coding
load_id: gene-SPO0077
locus_tag: SPO0077
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00359; match to protein family HMM TIGR01419
Source: Genbank
Position: CP000031.2:77195..77659 (- strand)
Length: 465
Dbxref: NCBI_GP:AAV93408.1
IMG: ptsN: PTS IIA-like nitrogen-regulatory protein PtsN
Note: identified by match to protein family HMM PF00359; match to protein family HMM TIGR01419
RefSeq: SPO_RS00390: PTS transporter subunit EIIA
gbkey: CDS
gene: ptsN
load_id: cds-AAV93408.1
locus_tag: SPO0077
parent_id: gene-SPO0077
product: PTS IIA-like nitrogen-regulatory protein PtsN
protein_id: AAV93408.1
transl_table: 11
translation: MELSSILKPNAVRVIGAASSKKRLFQEITDLAEATLKLDAQETLEALLERESLGPTGVGH GVALPHARVAGLDQVAGVFVLLEKPLDFGAVDRQPVDLAFALFAPEDAGVEHLKALALVS RTLREQAVCTKLRANPDPTKLYAILTESHPLQAA
>ptsN class=Sequence position=CP000031.2:77195..77659 (- strand)
ATGGAGCTTT CGAGCATCCT CAAACCAAAC GCGGTCCGCG TCATCGGTGC CGCATCGAGC AAGAAAAGAT TATTTCAGGA
AATCACGGAC TTGGCCGAGG CCACCCTGAA GCTGGACGCT CAGGAAACCC TCGAGGCCCT GCTCGAGCGT GAAAGCCTGG
GCCCGACCGG AGTCGGCCAT GGCGTCGCGC TGCCGCATGC GCGCGTCGCG GGCCTGGATC AGGTGGCGGG CGTGTTTGTC
CTGCTGGAAA AGCCGCTGGA TTTCGGCGCT GTCGACCGTC AGCCGGTCGA CCTGGCCTTT GCGCTGTTTG CGCCCGAAGA
CGCCGGTGTC GAACATCTCA AGGCGCTGGC GCTGGTCTCG CGCACCCTGC GCGAGCAGGC GGTCTGCACC AAGCTGCGCG
CCAACCCGGA TCCGACCAAG CTCTATGCCA TCCTGACCGA ATCACACCCG CTTCAAGCGG CGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7