Roseobase: Ruegeria pomeroyi DSS-3

Name: ptsN
Type: gene
Description:
Source: GenBank
Position: DSS3:77195..77659 (- strand)
Length: 465
Dbxref: GeneID:3193872
load_id: SPO0077
locus_tag: SPO0077
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:77195..77659 (- strand)
Length: 465
load_id: SPO0077.t01
parent_id: SPO0077
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00359; match to protein family HMM TIGR01419; NCBI:PTS lactose transporter subunit IIC; IMG:PTS IIA-like nitrogen-regulatory protein PtsN
Source: GenBank
Position: DSS3:77195..77659 (- strand)
Length: 465
Dbxref: GI:56695005
  GeneID:3193872
Note: identified by match to protein family HMM PF00359; match to protein family HMM TIGR01419
  NCBI:PTS lactose transporter subunit IIC
  IMG:PTS IIA-like nitrogen-regulatory protein PtsN
codon_start: 1
load_id: SPO0077.p01
locus_tag: SPO0077
parent_id: SPO0077.t01
product: PTS IIA-like nitrogen-regulatory protein PtsN
protein_id: REF_tigr:SPO0077
  YP_165351.1
transl_table: 11
translation: MELSSILKPNAVRVIGAASSKKRLFQEITDLAEATLKLDAQETLEALLERESLGPTGVGH GVALPHARVAGLDQVAGVFVLLEKPLDFGAVDRQPVDLAFALFAPEDAGVEHLKALALVS RTLREQAVCTKLRANPDPTKLYAILTESHPLQAA
Type: exon
Description:
Source: GenBank
Position: DSS3:77195..77659 (- strand)
Length: 465
parent_id: SPO0077.t01
> class=Sequence position=DSS3:77195..77659 (- strand)
ATGGAGCTTT CGAGCATCCT CAAACCAAAC GCGGTCCGCG TCATCGGTGC CGCATCGAGC AAGAAAAGAT TATTTCAGGA
AATCACGGAC TTGGCCGAGG CCACCCTGAA GCTGGACGCT CAGGAAACCC TCGAGGCCCT GCTCGAGCGT GAAAGCCTGG
GCCCGACCGG AGTCGGCCAT GGCGTCGCGC TGCCGCATGC GCGCGTCGCG GGCCTGGATC AGGTGGCGGG CGTGTTTGTC
CTGCTGGAAA AGCCGCTGGA TTTCGGCGCT GTCGACCGTC AGCCGGTCGA CCTGGCCTTT GCGCTGTTTG CGCCCGAAGA
CGCCGGTGTC GAACATCTCA AGGCGCTGGC GCTGGTCTCG CGCACCCTGC GCGAGCAGGC GGTCTGCACC AAGCTGCGCG
CCAACCCGGA TCCGACCAAG CTCTATGCCA TCCTGACCGA ATCACACCCG CTTCAAGCGG CGTGA
>ptsN class=Sequence position=DSS3:77195..77659 (- strand)
ATGGAGCTTT CGAGCATCCT CAAACCAAAC GCGGTCCGCG TCATCGGTGC CGCATCGAGC AAGAAAAGAT TATTTCAGGA
AATCACGGAC TTGGCCGAGG CCACCCTGAA GCTGGACGCT CAGGAAACCC TCGAGGCCCT GCTCGAGCGT GAAAGCCTGG
GCCCGACCGG AGTCGGCCAT GGCGTCGCGC TGCCGCATGC GCGCGTCGCG GGCCTGGATC AGGTGGCGGG CGTGTTTGTC
CTGCTGGAAA AGCCGCTGGA TTTCGGCGCT GTCGACCGTC AGCCGGTCGA CCTGGCCTTT GCGCTGTTTG CGCCCGAAGA
CGCCGGTGTC GAACATCTCA AGGCGCTGGC GCTGGTCTCG CGCACCCTGC GCGAGCAGGC GGTCTGCACC AAGCTGCGCG
CCAACCCGGA TCCGACCAAG CTCTATGCCA TCCTGACCGA ATCACACCCG CTTCAAGCGG CGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7