Roseobase: Ruegeria pomeroyi DSS-3

Name: radC
Type: CDS
Description: identified by similarity to SP:P25531; match to protein family HMM PF04002; match to protein family HMM TIGR00608; NCBI:hypothetical protein; IMG:
Source: GenBank
Position: DSS3:53600..54274 (+ strand)
Length: 675
Dbxref: GI:56694982
  GeneID:3195576
Note: identified by similarity to SP:P25531; match to protein family HMM PF04002; match to protein family HMM TIGR00608
  NCBI:hypothetical protein
  IMG:
codon_start: 1
load_id: SPO0054.p01
locus_tag: SPO0054
parent_id: SPO0054.t01
product: DNA repair protein RadC
protein_id: REF_tigr:SPO0054
  YP_165328.1
transl_table: 11
translation: MPSYIRDHRKRLRERFMTGGAAALPDYELLELVLFRSIPRQDVKPLARLLLDTFGDFNRV LTAPVERLAEVKGVGEAVITDLKILEASAHRMARARVMQRQVISSWDALLDYCHTTMAHR ETEQFRVFYLDRKNVLIADEEQARGTVDHVPVYPREVAKRALELNASALILVHNHPSGDP TPSQSDIDMTARIRSACEALGLTLHDHLIIGKSVELSFRAEGYL
>radC class=Sequence position=DSS3:53600..54274 (+ strand)
TTGCCATCCT ATATTCGGGA TCATCGCAAA CGCCTGCGGG AACGGTTCAT GACGGGCGGA GCGGCGGCGC TGCCGGATTA
CGAATTGCTG GAACTGGTGC TGTTTCGATC AATCCCGAGG CAAGACGTCA AGCCGCTGGC GCGGCTGCTG CTGGATACGT
TTGGTGATTT CAACCGGGTG CTGACCGCCC CGGTGGAACG GCTGGCCGAG GTCAAAGGCG TGGGCGAGGC GGTGATCACC
GACCTCAAGA TACTTGAGGC CAGCGCCCAC CGGATGGCCC GCGCACGGGT GATGCAGCGG CAGGTGATTT CCAGCTGGGA
CGCGCTGCTG GATTATTGCC ACACCACCAT GGCGCATCGC GAGACCGAAC AGTTCCGGGT CTTTTACCTC GACCGCAAGA
ACGTGCTGAT CGCGGATGAG GAACAGGCGC GCGGCACGGT CGATCACGTG CCGGTCTATC CGCGCGAGGT GGCCAAGCGG
GCGCTGGAGC TGAACGCCTC GGCGCTGATC CTGGTGCATA ATCACCCTTC GGGGGATCCG ACCCCGTCAC AATCGGATAT
CGACATGACG GCGCGGATCC GTTCCGCGTG TGAGGCGCTG GGGCTTACGT TGCATGACCA TCTGATCATC GGCAAATCGG
TCGAGCTGAG CTTTCGCGCC GAGGGATATC TTTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7