Roseobase: Ruegeria pomeroyi DSS-3

Name: rbsK
Type: gene
Description:
Source: Genbank
Position: CP000031.2:13857..14729 (+ strand)
Length: 873
gbkey: Gene
gene: rbsK
gene_biotype: protein_coding
load_id: gene-SPO0013
locus_tag: SPO0013
Parts:
Type: CDS
Description: identified by similarity to SP:P05054; match to protein family HMM PF00294
Source: Genbank
Position: CP000031.2:13857..14729 (+ strand)
Length: 873
Dbxref: NCBI_GP:AAV93344.1
IMG: rbsK: ribokinase
Note: identified by similarity to SP:P05054; match to protein family HMM PF00294
RefSeq: SPO_RS00065: ribokinase
gbkey: CDS
gene: rbsK
load_id: cds-AAV93344.1
locus_tag: SPO0013
parent_id: gene-SPO0013
product: ribokinase
protein_id: AAV93344.1
transl_table: 11
translation: MAIWNLGSINADMVYAVPHLPGPGETLAASGLERFLGGKGANMSVAAARAGSQVRHIGAV GPEGRWAIDRLTEYGVDTRHIATLEAPTGHAIIAVEPGGENLIVLLPGANRAISPERVGS VLLDAAPGDLLVMQNETSAQVEAARLGRERGLTVCYAAAPFDAQAVRDVLPWLDFLILNA VEAEQLQEATGLTPDQLPVSHVIVTLGSKGARHFDTDKGISTEYPAYRVKAVDTTGAGDT FTGYVLSGMDRGLPMPQAITQAMRAAALMVMRHGTADVIPDLKEVLAARF
>rbsK class=Sequence position=CP000031.2:13857..14729 (+ strand)
ATGGCGATCT GGAACCTCGG TTCGATCAAT GCGGACATGG TCTATGCCGT GCCGCATCTG CCCGGGCCGG GCGAAACCCT
GGCCGCCTCG GGGTTGGAGC GGTTTCTGGG CGGCAAGGGC GCCAATATGT CGGTGGCCGC CGCCCGCGCC GGATCGCAGG
TGCGCCATAT CGGCGCGGTG GGGCCGGAGG GGCGCTGGGC TATCGACCGG CTGACCGAAT ATGGCGTCGA TACGCGCCAT
ATCGCGACGC TTGAGGCACC CACCGGCCAT GCGATCATCG CGGTCGAGCC GGGGGGCGAG AACCTGATCG TTCTGTTGCC
CGGTGCCAAC CGGGCCATTT CACCCGAACG GGTCGGCAGT GTGCTTTTGG ATGCCGCGCC CGGTGATCTT CTGGTGATGC
AGAATGAAAC CAGCGCCCAG GTCGAAGCGG CGCGGCTGGG TCGCGAACGC GGTCTGACCG TGTGTTATGC CGCCGCCCCC
TTTGACGCGC AGGCGGTGCG CGATGTTCTG CCCTGGCTCG ATTTCCTGAT CCTGAACGCG GTCGAGGCCG AACAGCTGCA
AGAGGCGACC GGGCTGACAC CGGATCAGTT GCCGGTCTCG CATGTGATTG TCACGCTGGG GTCGAAAGGC GCGCGCCATT
TCGACACTGA CAAGGGGATT TCGACCGAGT ATCCGGCCTA TCGGGTCAAG GCGGTCGATA CCACCGGGGC GGGCGATACC
TTTACCGGCT ATGTGCTGTC CGGGATGGAT CGCGGCTTGC CGATGCCGCA GGCAATCACT CAAGCGATGC GCGCTGCCGC
ATTGATGGTG ATGCGCCACG GCACGGCCGA TGTGATCCCC GACCTGAAAG AGGTGCTGGC GGCGCGGTTC TAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7