Roseobase: Ruegeria pomeroyi DSS-3

Name: recQ
Type: gene
Description:
Source: GenBank
Position: DSS3:110244..112283 (- strand)
Length: 2040
Dbxref: GeneID:3194995
load_id: SPO0107
locus_tag: SPO0107
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:110244..112283 (- strand)
Length: 2040
load_id: SPO0107.t01
parent_id: SPO0107
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00270; match to protein family HMM PF00271; match to protein family HMM PF00570; match to protein family HMM TIGR00614; match to protein family HMM TIGR01389; NCBI:ATP-dependent DNA helicase RecQ; IMG:ATP-dependent DNA helicase RecQ (EC 3.6.1.-)
Source: GenBank
Position: DSS3:110244..112283 (- strand)
Length: 2040
Dbxref: GI:56695035
  GeneID:3194995
Note: identified by match to protein family HMM PF00270; match to protein family HMM PF00271; match to protein family HMM PF00570; match to protein family HMM TIGR00614; match to protein family HMM TIGR01389
  NCBI:ATP-dependent DNA helicase RecQ
  IMG:ATP-dependent DNA helicase RecQ (EC 3.6.1.-)
codon_start: 1
eC_number: 3.6.1.-
load_id: SPO0107.p01
locus_tag: SPO0107
parent_id: SPO0107.t01
product: ATP-dependent DNA helicase RecQ
protein_id: REF_tigr:SPO0107
  YP_165381.1
transl_table: 11
translation: MFDAAPLLRDVFGFDAFRPGQEEIAQAVAEGENVLAIMPTGGGKSLCFQLPALMREGVTV VISPLIALMRDQVRSLQEAGVEAGALTSGNTPEETEAVWQALEAGRLKLLYMAPERLASG AAMGMLRRIGVSLIAVDEAHCVSQWGHDFRPDYLRIGELRRALGVPLAAFTATADAETQA EIVAKLFDGEEPRSFLRGFDRPNIHLAFAAKDSPRRQILDFAGARRGQSGIVYCGTRAKT ETLAQALREDGHSACHYHGGMEAEDRRIVETRFAREDGLIVVATVAFGMGIDKPDIRWVA HADLPKSIEAYYQEIGRAGRDGGPAETLTLFGPDDIRLRRSQIDEGLAPPERRAADHARL NALLGLAEAMTCRRQTLLGYFGETEITCGKCDLCDSPAERFDGTTAVRMALSAMLRTEEW FGATHLIDILLGNQTDKIRDRRHDQLPTYGVGTEWNRAQWQAIFRQMMGRDLVRPDPERH GALRMTEAALPILRGEAGIELRKDTVSKAARRPAVKAMVNDEDAPLLSALKAKRRALAEA ARVPAYVIFPDRTLIEMAEKRPASLDQMARIGGIGAKKLERYGAMFLEVVSGAAEMLHPA RRKLAGRQTGNIYDRLLAVQADLARGPDGIDKPLSCSASQLAKVAQMRPDDRSGLEALLG DRRWERFGEAFLDVLGQTT
Type: exon
Description:
Source: GenBank
Position: DSS3:110244..112283 (- strand)
Length: 2040
parent_id: SPO0107.t01
> class=Sequence position=DSS3:110244..112283 (- strand)
ATGTTCGACG CCGCACCGCT GTTGCGAGAT GTGTTTGGAT TCGACGCCTT CCGCCCCGGG CAGGAGGAGA TCGCGCAGGC
CGTGGCCGAG GGCGAGAACG TGCTGGCGAT CATGCCGACG GGGGGCGGCA AGTCGCTGTG TTTCCAACTG CCGGCGCTGA
TGCGCGAGGG GGTGACGGTG GTGATCTCGC CGCTGATCGC CCTGATGCGC GACCAGGTGC GCAGCCTGCA AGAGGCGGGT
GTCGAGGCGG GGGCGCTGAC CTCGGGCAAC ACACCCGAGG AGACCGAGGC GGTCTGGCAG GCGCTGGAGG CGGGGCGGCT
GAAGCTGCTT TACATGGCCC CCGAACGGCT CGCATCGGGC GCGGCGATGG GGATGCTGCG GCGGATCGGG GTCAGCCTGA
TCGCGGTGGA CGAGGCTCAT TGCGTCAGCC AGTGGGGCCA TGATTTTCGC CCCGATTACC TGCGTATCGG CGAGCTGCGC
AGGGCGCTGG GCGTGCCGCT GGCCGCCTTT ACCGCCACGG CGGATGCCGA GACCCAGGCC GAGATCGTTG CGAAACTGTT
CGATGGCGAG GAACCGCGCA GTTTCCTGCG CGGGTTCGAC CGGCCCAATA TCCACCTGGC CTTTGCCGCC AAGGACAGCC
CGCGCCGCCA GATCCTGGAT TTCGCGGGCG CCCGGCGCGG CCAGTCGGGC ATCGTCTATT GCGGCACCCG GGCCAAGACC
GAGACGCTGG CGCAGGCCCT GCGCGAGGAC GGCCACAGCG CCTGTCACTA TCACGGCGGC ATGGAGGCCG AGGACCGCCG
CATCGTCGAG ACCCGCTTTG CCCGCGAGGA CGGGCTGATC GTGGTGGCGA CGGTGGCCTT TGGCATGGGT ATCGACAAGC
CCGATATCCG CTGGGTCGCC CATGCCGATC TGCCGAAATC CATCGAGGCC TATTATCAGG AGATCGGCCG TGCGGGCCGT
GATGGCGGGC CGGCCGAGAC ACTGACCCTG TTCGGCCCCG ACGACATCCG CCTGCGCCGC AGCCAGATCG ACGAAGGCCT
GGCCCCGCCC GAGCGCCGCG CCGCCGATCA TGCCCGGTTG AACGCGCTTC TGGGTCTGGC CGAGGCGATG ACCTGCCGTC
GACAGACCCT GCTGGGTTAT TTTGGCGAGA CCGAGATCAC CTGCGGCAAA TGCGATCTGT GCGACAGCCC GGCGGAACGG
TTCGATGGCA CAACCGCAGT GCGCATGGCC TTGTCGGCGA TGCTGCGGAC CGAGGAATGG TTCGGCGCGA CCCATCTGAT
CGACATCCTG CTGGGCAACC AGACCGACAA GATCCGCGAC CGCCGCCATG ACCAGTTGCC CACCTATGGG GTCGGCACCG
AATGGAACCG CGCCCAGTGG CAGGCGATCT TTCGTCAGAT GATGGGCCGC GACCTGGTGC GCCCAGATCC CGAACGCCAC
GGCGCGCTGC GGATGACCGA GGCGGCGCTG CCGATCCTGC GCGGCGAGGC CGGGATCGAG TTGCGCAAGG ATACGGTGAG
CAAGGCGGCG CGGCGTCCGG CGGTCAAGGC CATGGTCAAT GACGAGGACG CGCCGCTGCT GTCCGCGCTC AAGGCCAAGC
GCCGGGCGCT GGCCGAGGCG GCACGGGTCC CGGCCTATGT GATCTTTCCC GACCGCACCT TGATCGAAAT GGCCGAGAAG
CGCCCCGCAT CGCTGGACCA GATGGCCCGC ATCGGCGGCA TCGGCGCAAA GAAGTTGGAG CGTTACGGCG CCATGTTTCT
GGAGGTGGTG AGCGGTGCTG CCGAGATGCT GCACCCCGCC CGCCGCAAGC TGGCCGGGCG GCAGACCGGC AACATCTATG
ACCGGCTGTT GGCTGTGCAG GCCGATCTGG CGCGCGGCCC TGACGGCATC GACAAACCGC TCAGCTGTTC GGCGTCGCAA
CTGGCCAAGG TGGCGCAAAT GCGCCCCGAC GATCGGAGCG GACTTGAGGC GCTGTTGGGT GATCGACGCT GGGAACGTTT
TGGTGAGGCC TTTCTGGACG TGCTGGGCCA GACGACCTAG 
>recQ class=Sequence position=DSS3:110244..112283 (- strand)
ATGTTCGACG CCGCACCGCT GTTGCGAGAT GTGTTTGGAT TCGACGCCTT CCGCCCCGGG CAGGAGGAGA TCGCGCAGGC
CGTGGCCGAG GGCGAGAACG TGCTGGCGAT CATGCCGACG GGGGGCGGCA AGTCGCTGTG TTTCCAACTG CCGGCGCTGA
TGCGCGAGGG GGTGACGGTG GTGATCTCGC CGCTGATCGC CCTGATGCGC GACCAGGTGC GCAGCCTGCA AGAGGCGGGT
GTCGAGGCGG GGGCGCTGAC CTCGGGCAAC ACACCCGAGG AGACCGAGGC GGTCTGGCAG GCGCTGGAGG CGGGGCGGCT
GAAGCTGCTT TACATGGCCC CCGAACGGCT CGCATCGGGC GCGGCGATGG GGATGCTGCG GCGGATCGGG GTCAGCCTGA
TCGCGGTGGA CGAGGCTCAT TGCGTCAGCC AGTGGGGCCA TGATTTTCGC CCCGATTACC TGCGTATCGG CGAGCTGCGC
AGGGCGCTGG GCGTGCCGCT GGCCGCCTTT ACCGCCACGG CGGATGCCGA GACCCAGGCC GAGATCGTTG CGAAACTGTT
CGATGGCGAG GAACCGCGCA GTTTCCTGCG CGGGTTCGAC CGGCCCAATA TCCACCTGGC CTTTGCCGCC AAGGACAGCC
CGCGCCGCCA GATCCTGGAT TTCGCGGGCG CCCGGCGCGG CCAGTCGGGC ATCGTCTATT GCGGCACCCG GGCCAAGACC
GAGACGCTGG CGCAGGCCCT GCGCGAGGAC GGCCACAGCG CCTGTCACTA TCACGGCGGC ATGGAGGCCG AGGACCGCCG
CATCGTCGAG ACCCGCTTTG CCCGCGAGGA CGGGCTGATC GTGGTGGCGA CGGTGGCCTT TGGCATGGGT ATCGACAAGC
CCGATATCCG CTGGGTCGCC CATGCCGATC TGCCGAAATC CATCGAGGCC TATTATCAGG AGATCGGCCG TGCGGGCCGT
GATGGCGGGC CGGCCGAGAC ACTGACCCTG TTCGGCCCCG ACGACATCCG CCTGCGCCGC AGCCAGATCG ACGAAGGCCT
GGCCCCGCCC GAGCGCCGCG CCGCCGATCA TGCCCGGTTG AACGCGCTTC TGGGTCTGGC CGAGGCGATG ACCTGCCGTC
GACAGACCCT GCTGGGTTAT TTTGGCGAGA CCGAGATCAC CTGCGGCAAA TGCGATCTGT GCGACAGCCC GGCGGAACGG
TTCGATGGCA CAACCGCAGT GCGCATGGCC TTGTCGGCGA TGCTGCGGAC CGAGGAATGG TTCGGCGCGA CCCATCTGAT
CGACATCCTG CTGGGCAACC AGACCGACAA GATCCGCGAC CGCCGCCATG ACCAGTTGCC CACCTATGGG GTCGGCACCG
AATGGAACCG CGCCCAGTGG CAGGCGATCT TTCGTCAGAT GATGGGCCGC GACCTGGTGC GCCCAGATCC CGAACGCCAC
GGCGCGCTGC GGATGACCGA GGCGGCGCTG CCGATCCTGC GCGGCGAGGC CGGGATCGAG TTGCGCAAGG ATACGGTGAG
CAAGGCGGCG CGGCGTCCGG CGGTCAAGGC CATGGTCAAT GACGAGGACG CGCCGCTGCT GTCCGCGCTC AAGGCCAAGC
GCCGGGCGCT GGCCGAGGCG GCACGGGTCC CGGCCTATGT GATCTTTCCC GACCGCACCT TGATCGAAAT GGCCGAGAAG
CGCCCCGCAT CGCTGGACCA GATGGCCCGC ATCGGCGGCA TCGGCGCAAA GAAGTTGGAG CGTTACGGCG CCATGTTTCT
GGAGGTGGTG AGCGGTGCTG CCGAGATGCT GCACCCCGCC CGCCGCAAGC TGGCCGGGCG GCAGACCGGC AACATCTATG
ACCGGCTGTT GGCTGTGCAG GCCGATCTGG CGCGCGGCCC TGACGGCATC GACAAACCGC TCAGCTGTTC GGCGTCGCAA
CTGGCCAAGG TGGCGCAAAT GCGCCCCGAC GATCGGAGCG GACTTGAGGC GCTGTTGGGT GATCGACGCT GGGAACGTTT
TGGTGAGGCC TTTCTGGACG TGCTGGGCCA GACGACCTAG 

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7