Roseobase: Ruegeria pomeroyi DSS-3

Name: rimP
Type: gene
Description:
Source: Genbank
Position: CP000031.2:67637..68263 (- strand)
Length: 627
gbkey: Gene
gene: rimP
gene_biotype: protein_coding
load_id: gene-SPO0064
locus_tag: SPO0064
Parts:
Type: CDS
Description: identified by similarity to SP:Q8UJ48; match to protein family HMM PF02576
Source: Genbank
Position: CP000031.2:67637..68263 (- strand)
Length: 627
Dbxref: NCBI_GP:AAV93395.1
IMG: rimP: ribosome maturation factor RimP
Note: identified by similarity to SP:Q8UJ48; match to protein family HMM PF02576
RefSeq: SPO_RS00325: rimP: ribosome maturation factor RimP
gbkey: CDS
gene: rimP
load_id: cds-AAV93395.1
locus_tag: SPO0064
parent_id: gene-SPO0064
product: Ribosome maturation factor RimP
protein_id: AAV93395.1
transl_table: 11
translation: MTNNLIAKAAIDRRLAEIVSPVIADLGYELVRIRLMSGKSTTLQIMADKPDGGIEVDDCA AISNAVSATLDVEDPILDAYTLEVSSPGIDRPLTRLKDFEMFEGYEAKIETTEMIDGRRR FRGELAGIEGNEVLINLDQNGETVTIGLEFDWLSDAKLVLTDDLIKEMLRQRKAAGVLNE DQFDEIVEEAPETGATTMARDGSEEETK
>rimP class=Sequence position=CP000031.2:67637..68263 (- strand)
ATGACCAACA ACCTGATAGC AAAGGCCGCC ATCGACCGGC GCCTGGCCGA GATCGTCAGC CCCGTGATCG CGGATCTGGG
ATACGAGCTG GTGCGCATTC GCCTGATGAG CGGCAAGAGC ACCACGCTTC AGATCATGGC CGACAAGCCC GATGGCGGCA
TCGAGGTGGA CGATTGCGCC GCGATCTCGA ACGCGGTCAG CGCCACGCTG GATGTCGAGG ATCCGATCCT GGATGCCTAT
ACGCTCGAAG TGTCGAGCCC GGGCATCGAC CGGCCGCTGA CCCGGCTCAA GGATTTCGAG ATGTTCGAAG GCTATGAGGC
CAAGATCGAA ACGACCGAGA TGATCGACGG CCGCCGCCGG TTCAGGGGCG AGCTGGCCGG CATCGAGGGC AACGAGGTGC
TGATCAACCT CGACCAGAAT GGCGAGACGG TGACCATCGG CCTGGAGTTC GACTGGCTGA GCGATGCCAA GCTGGTTCTG
ACCGACGACC TGATCAAGGA AATGCTGCGC CAGCGCAAGG CTGCCGGTGT CCTGAACGAA GATCAATTCG ACGAAATCGT
AGAGGAAGCG CCCGAAACGG GCGCCACGAC CATGGCCCGC GACGGGTCCG AAGAGGAGAC GAAGTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7