Roseobase: Ruegeria pomeroyi DSS-3

Name: rph
Type: gene
Description:
Source: GenBank
Position: DSS3:6294..7007 (- strand)
Length: 714
Dbxref: GeneID:3193125
load_id: SPO0008
locus_tag: SPO0008
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:6294..7007 (- strand)
Length: 714
load_id: SPO0008.t01
parent_id: SPO0008
Parts:
Type: CDS
Description: identified by similarity to SP:P03842; match to protein family HMM PF01138; match to protein family HMM PF03725; match to protein family HMM TIGR01966; NCBI:ribonuclease PH; IMG:RNAse PH
Source: GenBank
Position: DSS3:6294..7007 (- strand)
Length: 714
Dbxref: GI:56694936
  GeneID:3193125
Note: identified by similarity to SP:P03842; match to protein family HMM PF01138; match to protein family HMM PF03725; match to protein family HMM TIGR01966
  NCBI:ribonuclease PH
  IMG:RNAse PH
codon_start: 1
eC_number: 2.7.7.56
load_id: SPO0008.p01
locus_tag: SPO0008
parent_id: SPO0008.t01
product: ribonuclease PH
protein_id: REF_tigr:SPO0008
  YP_165281.1
transl_table: 11
translation: MRPSGRDLSEMRPVSIETGFTKHAEGSCLIKMGDTHVLCTATIEDRVPPFIKGSGLGWVT AEYGMLPRATNTRMRREAASGKQGGRTVEIQRLIGRALRAGVDRVALGERQITVDCDVIQ ADGGTRCASITGGWVALRLAVNKLMKAGDVISDPLVDPVAAVSCGIYAGQPVLDLDYPED SEAGVDGNFIMTGSGKLIEVQMSAEGSVFNRAQLDQLLGLAEKGVGELVAAQMAATA
Type: exon
Description:
Source: GenBank
Position: DSS3:6294..7007 (- strand)
Length: 714
parent_id: SPO0008.t01
> class=Sequence position=DSS3:6294..7007 (- strand)
ATGCGACCCT CTGGACGAGA TCTAAGCGAA ATGCGCCCGG TTTCAATCGA AACCGGTTTC ACCAAACATG CCGAAGGCTC
GTGCCTGATC AAGATGGGCG ACACGCATGT CCTGTGCACC GCCACCATCG AGGACCGCGT GCCCCCCTTT ATCAAGGGCT
CGGGCCTGGG CTGGGTCACC GCCGAATACG GCATGCTGCC GCGTGCCACC AACACCCGCA TGCGGCGCGA GGCCGCCAGC
GGCAAGCAAG GCGGCCGTAC CGTTGAAATC CAGCGCCTGA TCGGCCGCGC CCTGCGCGCC GGCGTTGACC GGGTGGCCCT
GGGAGAACGC CAGATCACCG TCGACTGTGA TGTGATCCAG GCCGATGGCG GCACCCGCTG CGCCTCGATC ACCGGTGGTT
GGGTGGCCCT GCGTCTGGCG GTGAACAAGC TGATGAAGGC TGGCGACGTG ATTTCCGATC CGCTGGTCGA TCCGGTCGCC
GCCGTGTCCT GCGGCATCTA TGCCGGGCAA CCGGTGCTGG ACCTAGATTA CCCCGAGGAC AGCGAGGCAG GCGTTGACGG
CAATTTCATC ATGACCGGTT CGGGCAAGCT GATCGAGGTG CAGATGAGCG CCGAGGGCTC TGTCTTCAAC CGCGCGCAGC
TGGATCAGCT GCTAGGCCTC GCCGAAAAGG GCGTAGGCGA ACTGGTTGCC GCGCAAATGG CCGCCACCGC ATGA
>rph class=Sequence position=DSS3:6294..7007 (- strand)
ATGCGACCCT CTGGACGAGA TCTAAGCGAA ATGCGCCCGG TTTCAATCGA AACCGGTTTC ACCAAACATG CCGAAGGCTC
GTGCCTGATC AAGATGGGCG ACACGCATGT CCTGTGCACC GCCACCATCG AGGACCGCGT GCCCCCCTTT ATCAAGGGCT
CGGGCCTGGG CTGGGTCACC GCCGAATACG GCATGCTGCC GCGTGCCACC AACACCCGCA TGCGGCGCGA GGCCGCCAGC
GGCAAGCAAG GCGGCCGTAC CGTTGAAATC CAGCGCCTGA TCGGCCGCGC CCTGCGCGCC GGCGTTGACC GGGTGGCCCT
GGGAGAACGC CAGATCACCG TCGACTGTGA TGTGATCCAG GCCGATGGCG GCACCCGCTG CGCCTCGATC ACCGGTGGTT
GGGTGGCCCT GCGTCTGGCG GTGAACAAGC TGATGAAGGC TGGCGACGTG ATTTCCGATC CGCTGGTCGA TCCGGTCGCC
GCCGTGTCCT GCGGCATCTA TGCCGGGCAA CCGGTGCTGG ACCTAGATTA CCCCGAGGAC AGCGAGGCAG GCGTTGACGG
CAATTTCATC ATGACCGGTT CGGGCAAGCT GATCGAGGTG CAGATGAGCG CCGAGGGCTC TGTCTTCAAC CGCGCGCAGC
TGGATCAGCT GCTAGGCCTC GCCGAAAAGG GCGTAGGCGA ACTGGTTGCC GCGCAAATGG CCGCCACCGC ATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7