Roseobase: Ruegeria pomeroyi DSS-3

Name: phnK
Type: CDS
Description: identified by similarity to SP:P16678
Source: Genbank
Position: CP000031.2:478684..479454 (+ strand)
Length: 771
Dbxref: NCBI_GP:AAV93790.1
IMG: phnK: alkylphosphonate utilization protein PhnK
Note: identified by similarity to SP:P16678
RefSeq: SPO_RS02380: phnK: phosphonate C-P lyase system protein PhnK
gbkey: CDS
gene: phnK
load_id: cds-AAV93790.1
locus_tag: SPO0472
parent_id: gene-SPO0472
product: alkylphosphonate utilization protein PhnK
protein_id: AAV93790.1
transl_table: 11
translation: MSPLLEVRGIEKRYGARIGCTNVSFDLYPGEVMGIVGESGSGKSTLLNCLAGHLVPDAGQ VIFDTRHTGPVDTVTMSEPERRMLSRTDWAFVHQHARDGLRMSVSAGGNIGERLMAVGDR HYGRIRASALDWLDRVEIDGARIDDRPTAFSGGMQQRLQIARNLVTGPRLVFMDEPTGGL DVSVQARLLDLLRGLVRRMGLSAIIVTHDLAVVRLLADRLMVMKDGRVVESGLTDQVLDD PQHGYTQLLVSSVLQV
>phnK class=Sequence position=CP000031.2:478684..479454 (+ strand)
ATGAGCCCCT TGTTGGAGGT GCGGGGAATC GAAAAGCGCT ATGGTGCGCG GATCGGCTGC ACCAATGTGA GTTTCGATCT
CTACCCCGGC GAGGTGATGG GGATCGTGGG TGAAAGCGGC TCGGGCAAGT CGACGCTGCT CAATTGTCTG GCGGGTCATC
TGGTGCCCGA TGCGGGGCAG GTGATCTTTG ACACCCGCCA TACGGGGCCG GTGGATACGG TCACCATGTC GGAACCCGAG
CGGCGGATGC TGTCGCGCAC GGACTGGGCC TTTGTGCATC AGCATGCCCG CGACGGGCTG CGCATGTCGG TCTCGGCGGG
CGGCAATATC GGTGAACGGC TGATGGCGGT GGGGGATCGG CATTATGGCC GCATCCGCGC CTCCGCGCTC GATTGGCTGG
ACCGCGTCGA GATCGACGGC GCCCGGATCG ACGACCGGCC CACGGCTTTT TCCGGCGGCA TGCAGCAGCG CTTGCAGATC
GCGCGAAACC TGGTGACAGG TCCCCGGCTG GTGTTCATGG ACGAACCCAC CGGCGGCCTC GACGTGAGTG TACAGGCGCG
TCTTCTGGAC CTCTTGCGCG GATTGGTGCG GCGGATGGGT TTGAGCGCCA TCATCGTCAC CCACGATCTG GCGGTGGTGC
GCCTGCTGGC CGACCGGCTG ATGGTGATGA AGGACGGGCG CGTGGTCGAA AGCGGGCTGA CCGATCAGGT GCTGGACGAT
CCGCAGCATG GCTATACCCA ACTGCTGGTG TCGAGTGTGT TGCAGGTTTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7