Roseobase: Ruegeria pomeroyi DSS-3

Name: phnL
Type: gene
Description:
Source: Genbank
Position: CP000031.2:479522..480205 (+ strand)
Length: 684
gbkey: Gene
gene: phnL
gene_biotype: protein_coding
load_id: gene-SPO0473
locus_tag: SPO0473
Parts:
Type: CDS
Description: identified by similarity to SP:P16679
Source: Genbank
Position: CP000031.2:479522..480205 (+ strand)
Length: 684
Dbxref: NCBI_GP:AAV93791.1
IMG: phnL: alkylphosphonate utilization protein PhnL
Note: identified by similarity to SP:P16679
RefSeq: SPO_RS02385: phnL: phosphonate C-P lyase system protein PhnL
gbkey: CDS
gene: phnL
load_id: cds-AAV93791.1
locus_tag: SPO0473
parent_id: gene-SPO0473
product: alkylphosphonate utilization protein PhnL
protein_id: AAV93791.1
transl_table: 11
translation: MIDIRDVSKSFTLHNQGSAVIRVMEGASLHVAPGECVALTGASGAGKSTLMRVIYGNYLA ASGSVLVGGLDVVQAEPREILQLRREVLGYVSQFLRVVPRVPTVEVVAEPLLALGADPDA ARARAEALLSRLNIPERLWKLSPTTFSGGEQQRVNIARGFAHAYPALLLDEPTASLDAAN RAVVLELIEEAKARGAAIVGIFHDVEARARVCDRVVDVSAFTPGAAA
>phnL class=Sequence position=CP000031.2:479522..480205 (+ strand)
ATGATCGACA TCCGTGACGT CAGCAAGAGT TTCACCCTGC ACAATCAGGG CAGCGCGGTG ATCCGTGTGA TGGAGGGGGC
CTCGTTGCAT GTGGCGCCAG GCGAATGCGT GGCGCTGACC GGTGCGTCGG GGGCGGGCAA GTCCACCCTG ATGCGGGTGA
TCTATGGCAA TTACCTCGCG GCCTCCGGCT CTGTCCTTGT GGGTGGGCTG GACGTGGTCC AAGCCGAGCC GCGCGAGATT
CTGCAGCTGC GCCGTGAGGT ACTGGGCTAT GTCAGCCAGT TCCTGCGGGT GGTGCCACGG GTGCCGACGG TCGAGGTTGT
GGCCGAGCCG CTCCTGGCGT TGGGCGCCGA CCCGGATGCA GCGCGGGCGC GGGCCGAGGC GCTGCTGAGC CGGCTCAACA
TCCCCGAGCG GCTCTGGAAA CTGAGCCCCA CCACCTTCTC AGGCGGCGAG CAACAGCGCG TGAACATCGC GCGTGGCTTT
GCCCATGCCT ATCCGGCGCT GTTGCTGGAT GAACCGACGG CGAGCCTGGA TGCGGCGAAC CGCGCGGTGG TGCTGGAACT
GATCGAGGAA GCCAAGGCGC GCGGGGCGGC GATCGTGGGT ATCTTTCACG ATGTCGAGGC ACGGGCGCGG GTCTGTGACC
GGGTGGTCGA TGTCTCGGCC TTTACCCCGG GGGCGGCCGC ATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7