Roseobase: Ruegeria pomeroyi DSS-3

Name: rumA
Type: gene
Description:
Source: Genbank
Position: CP000031.2:29456..30709 (+ strand)
Length: 1254
gbkey: Gene
gene: rumA
gene_biotype: protein_coding
load_id: gene-SPO0029
locus_tag: SPO0029
Parts:
Type: CDS
Description: identified by similarity to SP:P55135
Source: Genbank
Position: CP000031.2:29456..30709 (+ strand)
Length: 1254
Dbxref: NCBI_GP:AAV93360.1
IMG: rumA: 23S rRNA m(5)U-1939 methyltransferase (EC 2.1.1.190)
Note: identified by similarity to SP:P55135
RefSeq: SPO_RS00145: class I SAM-dependent RNA methyltransferase
gbkey: CDS
gene: rumA
load_id: cds-AAV93360.1
locus_tag: SPO0029
parent_id: gene-SPO0029
product: 23S rRNA (Uracil-5-)-methyltransferase rumA
protein_id: AAV93360.1
transl_table: 11
translation: MPLYQAAMTQEITITRLGHQGDGIAPGPVYVPRSLPGEVVSGTPEGDRLADMRVVTPSPH RVAPPCRHYRACGGCQLQHASDGFVAEWKQEVVRAALAAQGIEAVMRPVHTSPPQSRRRA TIAVRRTKKGALAGFHGRASDVITEIPDCHLLDPALLAAIPMAEALAMLGGSRKGVMAVT LTLSVAGLDVAVRGGKPLDGPLEVALGQLAEVQGLARLAWEDEVIAMRHPPAQNFGKAAV VPPPGAFLQATRDGEQALLAAVRETIAGARRVADLFAGCGTFALPLAETAEVHAVEGESA MTAALDRGWRRAQGLKRVTTEARDLFRRPLLPDELAAFDAVVLDPPRAGAEAQVAELARA KPPVIAYVSCNPVTFARDAKTLVQAGYSLNWVQVVDQFRWSAHVELAAAFSLAHIGG
>rumA class=Sequence position=CP000031.2:29456..30709 (+ strand)
GTGCCCCTGT ATCAGGCGGC CATGACACAA GAGATCACCA TTACACGGCT GGGCCATCAG GGCGACGGGA TCGCCCCGGG
CCCGGTCTAT GTGCCGCGCA GCCTGCCGGG CGAGGTGGTC AGCGGCACGC CCGAGGGCGA CAGACTGGCC GATATGCGGG
TGGTGACACC GTCGCCGCAT CGAGTGGCGC CGCCCTGCCG CCATTACCGC GCCTGCGGCG GCTGCCAGTT GCAGCACGCC
TCGGACGGGT TCGTCGCCGA GTGGAAGCAA GAGGTGGTGC GCGCCGCATT GGCGGCGCAA GGGATCGAGG CGGTGATGCG
CCCCGTTCAT ACCTCGCCGC CGCAGTCACG CCGCCGCGCA ACCATCGCGG TGCGCCGCAC TAAAAAGGGT GCGCTTGCCG
GGTTTCATGG CCGCGCCTCG GACGTGATCA CCGAGATTCC GGATTGCCAT TTGCTCGACC CTGCGCTGCT TGCCGCCATT
CCGATGGCCG AGGCGTTGGC CATGCTGGGC GGCAGCCGCA AGGGGGTCAT GGCGGTCACG CTGACCCTGT CGGTGGCTGG
GCTAGATGTG GCGGTGCGCG GTGGCAAGCC ACTGGACGGC CCGCTTGAGG TGGCGCTGGG CCAGTTGGCC GAGGTGCAGG
GGCTGGCCCG GCTGGCCTGG GAAGACGAGG TGATCGCCAT GCGTCACCCG CCGGCGCAAA ACTTCGGCAA GGCGGCGGTC
GTGCCGCCGC CGGGCGCCTT TCTGCAGGCC ACCCGCGACG GGGAACAGGC GTTGTTGGCA GCGGTGCGGG AAACGATTGC
GGGCGCCCGC CGGGTCGCCG ATCTGTTTGC CGGCTGCGGC ACCTTTGCCC TGCCGCTGGC CGAAACCGCC GAGGTGCACG
CGGTCGAGGG TGAGAGCGCG ATGACTGCCG CGCTTGATCG GGGCTGGCGT CGTGCGCAGG GCCTGAAGCG CGTGACCACC
GAGGCGCGCG ATCTGTTCCG CCGCCCGCTG CTGCCCGACG AACTGGCCGC ATTCGACGCG GTGGTGCTGG ACCCGCCCCG
CGCCGGGGCC GAGGCGCAGG TGGCCGAACT GGCCCGCGCC AAACCACCCG TCATCGCCTA TGTCAGCTGT AACCCGGTGA
CCTTTGCCCG CGATGCCAAA ACGCTGGTTC AGGCTGGATA TAGCCTGAAT TGGGTGCAGG TGGTCGATCA GTTCCGCTGG
TCGGCACATG TGGAGCTTGC GGCGGCCTTC TCGCTGGCCC ATATCGGCGG CTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7