Roseobase: Ruegeria pomeroyi DSS-3

Name: secA
Type: CDS
Description: identified by match to protein family HMM PF00271; match to protein family HMM PF01043; match to protein family HMM PF02810; match to protein family HMM PF07516; match to protein family HMM PF07517; match to protein family HMM TIGR00963; NCBI:protein translocase subunit SecA 1; IMG:
Source: GenBank
Position: DSS3:57011..59716 (- strand)
Length: 2706
Dbxref: GI:56694985
  GeneID:3194508
Note: identified by match to protein family HMM PF00271; match to protein family HMM PF01043; match to protein family HMM PF02810; match to protein family HMM PF07516; match to protein family HMM PF07517; match to protein family HMM TIGR00963
  NCBI:protein translocase subunit SecA 1
  IMG:
codon_start: 1
load_id: SPO0057.p01
locus_tag: SPO0057
parent_id: SPO0057.t01
product: preprotein translocase, SecA subunit
protein_id: REF_tigr:SPO0057
  YP_165331.1
transl_table: 11
translation: MLGLGTLAKKVFGTPNDRKIKATRPVVAQINALEEEFAKLTDEGLKQKTDELRKRALDGE SLDALLPEAFANCREAGKRALGLRAFDTQLMGGIFLHQGNISEMKTGEGKTLVATFPAYL NALTGKGVHVVTVNEYLAKRDSEWMGKVFAALGMTTGVIWSGQPDAEKMAAYESDITYAT NNELGFDYLRDNMKGELSEVYQKQHNFAIVDEVDSILIDEARTPLIISGPAQDRSDLYVA IDALLPALSDDHFELDEKTRNVTFTDEGNEFLEAQLVARGLLPEGQSLYDPESTTIVHHV NQGLRAHKLFQRDKDYIVRDGEVVLIDEFTGRMMPGRRLSDGLHQAIEAKENAQIQPENV TLASVTFQNYFRLYDKLSGMTGTALTEAEEFAEIYGLGVVEVPTNRPIARTDEDDQVYRT AAEKYGAMIDETKKAHEKGQPVLLGTTSIEKSEMLSQMLTKEGIEHNVLNARQHEREAQI VAEAGRYGAVTIATNMAGRGTDIQLGGNVEMKVLEALAENPEADPVELRAAEEARHAEEK QKVLDAGGLYVMASERHESRRIDNQLRGRSGRQGDPGRTVFYLSLEDDLMRIFGSERLDK VLTTLGMKEGEAIIHPWVNKSLERAQAKVEGRNFDMRKNVLKFDDVMNDQRKVIFNQRRE IMATEDLSDVVADMREQVIDDLIDEYMPPKTYADQWDTQGLYAAVIEKLGIDVPVIEWAA EEGVDDDEIRERLIKASGDYMESKAADFGAENMRNIEKQVLLQTIDSKWREHLLKLEHLR SVVGFRGYAQRDPLNEYKTESFQLFEGLLDSLRETVTQQLSRVRMLSEEEQRQMMAQMMA QQNQAEQAAVQAEAVAEAKASGDARPGFVEDDPSTWGNPARNDLCPCGSGKKFKHCHGRL A
>secA class=Sequence position=DSS3:57011..59716 (- strand)
ATGCTGGGAC TTGGAACGCT TGCCAAAAAG GTGTTCGGAA CGCCGAATGA CCGCAAGATC AAGGCAACCC GTCCGGTGGT
CGCCCAGATC AACGCGCTGG AAGAAGAGTT TGCCAAGCTC ACCGACGAGG GGCTTAAGCA GAAGACCGAC GAGCTGCGCA
AACGCGCGCT GGACGGCGAA AGCCTGGATG CGCTGCTGCC CGAGGCATTT GCAAACTGCC GCGAAGCCGG CAAGCGGGCG
CTTGGCCTGC GCGCCTTCGA CACCCAGCTG ATGGGCGGCA TCTTTCTGCA CCAGGGCAAT ATCAGCGAGA TGAAGACGGG
CGAAGGCAAG ACGCTGGTCG CAACCTTTCC CGCCTATCTG AACGCGCTGA CCGGCAAGGG TGTGCATGTG GTCACGGTGA
ACGAATACCT GGCCAAGCGC GACTCGGAAT GGATGGGCAA GGTGTTTGCC GCGCTGGGCA TGACCACCGG CGTGATCTGG
TCGGGCCAGC CCGATGCCGA GAAGATGGCC GCCTATGAAA GCGACATCAC CTATGCCACC AACAACGAGC TTGGCTTCGA
CTATCTGCGC GACAACATGA AGGGCGAGCT GAGTGAGGTC TATCAGAAAC AGCACAATTT CGCGATCGTG GACGAGGTCG
ACTCGATCCT GATCGACGAG GCGCGCACGC CGCTGATCAT CTCGGGCCCG GCACAGGACC GCTCGGACCT TTATGTCGCC
ATCGACGCGC TGCTGCCCGC GCTGTCGGAC GATCATTTCG AACTGGACGA AAAGACCCGC AACGTCACCT TTACCGACGA
GGGGAACGAG TTCCTCGAGG CGCAGCTGGT CGCGCGCGGC CTGCTGCCCG AGGGTCAGTC GCTCTATGAT CCCGAAAGCA
CGACCATCGT GCACCACGTC AACCAGGGCC TGCGCGCGCA CAAGCTGTTC CAACGCGACA AGGATTACAT CGTGCGCGAC
GGCGAGGTCG TGCTGATCGA CGAATTCACC GGCCGCATGA TGCCGGGCCG CCGCCTGTCG GACGGTCTGC ACCAGGCGAT
CGAGGCCAAG GAAAACGCCC AGATCCAGCC CGAGAACGTG ACGCTGGCCA GCGTGACCTT CCAGAACTAC TTCCGCCTCT
ATGACAAGCT TTCCGGCATG ACCGGTACCG CCCTGACCGA GGCCGAGGAA TTCGCCGAGA TCTATGGTCT GGGCGTGGTC
GAGGTTCCCA CCAACCGGCC CATCGCCCGT ACCGACGAGG ACGATCAGGT CTATCGCACC GCCGCCGAGA AATACGGCGC
CATGATCGAC GAGACCAAGA AGGCGCATGA AAAGGGCCAG CCGGTCCTGC TGGGCACCAC CTCGATCGAG AAATCCGAGA
TGCTGAGCCA GATGCTGACC AAGGAAGGCA TCGAACACAA CGTCCTGAAC GCCCGCCAGC ACGAGCGCGA GGCGCAGATC
GTGGCCGAGG CGGGCCGCTA TGGCGCGGTG ACCATCGCCA CCAACATGGC CGGTCGCGGC ACCGACATCC AGCTGGGCGG
CAATGTCGAG ATGAAGGTTC TCGAAGCACT TGCCGAAAAC CCCGAGGCCG ACCCCGTCGA ACTGCGCGCC GCCGAAGAGG
CCCGCCATGC CGAGGAAAAG CAAAAGGTGC TGGATGCCGG CGGCCTTTAT GTGATGGCTT CGGAGCGGCA CGAAAGCCGC
CGTATCGACA ACCAGCTGCG CGGCCGTTCC GGCCGCCAGG GCGACCCGGG CCGCACCGTG TTCTACCTCA GTCTCGAAGA
CGACCTGATG CGCATCTTTG GCAGCGAGCG GCTCGACAAG GTGCTGACCA CGCTGGGCAT GAAGGAAGGC GAGGCGATCA
TTCACCCTTG GGTGAACAAA TCTCTCGAAC GCGCCCAGGC CAAGGTCGAG GGCCGCAATT TCGACATGCG CAAGAACGTG
CTGAAATTCG ACGACGTGAT GAACGATCAG CGCAAGGTGA TCTTCAACCA GCGGCGCGAG ATCATGGCGA CCGAGGACCT
GTCGGACGTG GTTGCGGATA TGCGCGAACA GGTGATCGAC GACCTGATCG ACGAATACAT GCCGCCCAAG ACCTATGCCG
ATCAGTGGGA TACCCAAGGC CTTTATGCCG CCGTTATCGA AAAGCTGGGC ATCGACGTGC CGGTGATTGA ATGGGCCGCC
GAAGAGGGCG TGGACGATGA CGAGATCCGC GAACGCCTGA TCAAGGCCTC GGGCGACTAC ATGGAAAGCA AGGCCGCCGA
CTTCGGTGCC GAGAACATGC GCAACATCGA AAAACAGGTG TTGTTGCAGA CCATCGACAG CAAATGGCGC GAACACCTGC
TCAAGCTGGA ACACCTGCGC TCGGTCGTCG GTTTCCGAGG CTACGCGCAG CGCGATCCGC TGAACGAATA CAAGACCGAA
AGCTTTCAGC TGTTCGAGGG GCTGCTGGAC AGCCTGCGCG AGACAGTGAC ACAGCAACTG TCGCGCGTGC GCATGTTGAG
CGAAGAGGAA CAGCGCCAGA TGATGGCGCA GATGATGGCG CAGCAAAACC AGGCGGAACA GGCGGCTGTT CAGGCCGAAG
CGGTGGCCGA GGCCAAGGCC TCGGGCGATG CGCGCCCCGG CTTTGTCGAG GATGACCCCA GCACCTGGGG CAACCCCGCG
CGCAACGATC TGTGCCCCTG CGGGTCGGGC AAGAAGTTCA AGCATTGCCA CGGGCGGCTC GCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7