Roseobase: Ruegeria pomeroyi DSS-3

Name: thiD
Type: gene
Description:
Source: Genbank
Position: CP000031.2:46122..46925 (+ strand)
Length: 804
gbkey: Gene
gene: thiD
gene_biotype: protein_coding
load_id: gene-SPO0045
locus_tag: SPO0045
Parts:
Type: CDS
Description: identified by similarity to SP:P76422; match to protein family HMM TIGR00097
Source: Genbank
Position: CP000031.2:46122..46925 (+ strand)
Length: 804
Dbxref: NCBI_GP:AAV93376.1
IMG: thiD: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
Note: identified by similarity to SP:P76422; match to protein family HMM TIGR00097
RefSeq: SPO_RS00225: thiD: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
gbkey: CDS
gene: thiD
load_id: cds-AAV93376.1
locus_tag: SPO0045
parent_id: gene-SPO0045
product: phosphomethylpyrimidine kinase
protein_id: AAV93376.1
transl_table: 11
translation: MVPIALTIAGSDSGGGAGIQADLKAMSALGIYGASVITAVTAQNTCAVTAVHEIPTEIIR AQIEAVLDDLDVRAIKIGMLATPEIIGAVADAIAGFDGPVVLDPVMVAKSGDALLAAEAV ASLKERLLPRATLLTPNLPEAARLLSLRDAADQDEMVSQARALIALGAEAVLMKGGHAKG AICHDLLVGRAGVLAEFSAPRRMTKNTHGTGCTLSSAIAAGLAKGRTLKAAVRDAHTYLQ GAIVAADRLGVGKGHGPVHHFHRVWSA
>thiD class=Sequence position=CP000031.2:46122..46925 (+ strand)
ATGGTTCCGA TTGCCTTGAC GATTGCAGGA TCCGACAGCG GCGGCGGCGC GGGCATTCAG GCCGATCTGA AGGCGATGTC
GGCGCTGGGC ATCTATGGTG CCTCGGTGAT CACGGCGGTG ACCGCACAGA ACACATGCGC AGTGACGGCG GTGCATGAGA
TTCCCACCGA AATCATTCGG GCGCAGATCG AGGCGGTTCT GGACGATCTC GACGTGCGCG CGATCAAGAT CGGCATGCTG
GCAACGCCCG AGATCATCGG GGCAGTCGCC GACGCCATTG CCGGGTTTGA CGGGCCTGTG GTGCTCGATC CGGTGATGGT
GGCGAAATCG GGCGATGCGC TGCTGGCGGC AGAGGCGGTG GCCAGCCTGA AAGAGCGGCT GCTGCCCCGT GCGACACTGC
TGACACCAAA CCTGCCCGAG GCGGCGCGCC TGCTGTCGTT GCGCGATGCG GCCGACCAGG ATGAAATGGT CAGCCAGGCG
CGCGCCTTGA TCGCGCTGGG GGCCGAGGCC GTGCTGATGA AGGGTGGGCA TGCCAAGGGC GCGATTTGTC ATGATCTGCT
GGTGGGGCGG GCCGGGGTGC TGGCAGAGTT CTCGGCTCCG CGCCGCATGA CAAAGAACAC CCATGGTACA GGTTGCACGC
TCAGCTCTGC CATTGCCGCC GGGCTGGCCA AGGGCCGGAC GCTGAAAGCC GCGGTGCGGG ATGCGCATAC CTATCTGCAA
GGCGCGATCG TGGCGGCGGA TCGCTTGGGT GTGGGGAAGG GTCACGGACC GGTTCATCAC TTTCACAGGG TCTGGTCGGC
ATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7