Roseobase: Ruegeria pomeroyi DSS-3

Name: thiE
Type: CDS
Description: identified by similarity to SP:P30137; match to protein family HMM PF02581; match to protein family HMM TIGR00693
Source: Genbank
Position: CP000031.2:48842..49438 (+ strand)
Length: 597
Dbxref: NCBI_GP:AAV93379.1
IMG: thiE: thiamine-phosphate diphosphorylase
Note: identified by similarity to SP:P30137; match to protein family HMM PF02581; match to protein family HMM TIGR00693
RefSeq: SPO_RS00245: thiamine phosphate synthase
gbkey: CDS
gene: thiE
load_id: cds-AAV93379.1
locus_tag: SPO0048
parent_id: gene-SPO0048
product: thiamine-phosphate pyrophosphorylase
protein_id: AAV93379.1
transl_table: 11
translation: MTLDRFYPIFDHTDWLRRMLPLGVKLVQLRIKDQSDPVIRAEIDTARDLCRAHGAVLVIN DYWQAAIDAGCDWLHLGQEDLDQADLPAIRKAGLRLGVSTHDDDELERVLGMDPDYVALG PVYPTILKQMKWHQQGLPRVTEWKARVGSIPLVGIGGMSVERAPGVLGAGADIVSVVTDI TLNADPEARVHQWIEVTR
>thiE class=Sequence position=CP000031.2:48842..49438 (+ strand)
ATGACGCTCG ACCGGTTTTA TCCGATCTTC GACCATACCG ACTGGCTGCG CCGGATGCTG CCGCTTGGGG TCAAGCTGGT
GCAGCTCAGG ATCAAGGACC AGTCCGACCC GGTGATCCGC GCCGAGATTG ACACCGCGCG CGACCTCTGC CGCGCGCATG
GCGCGGTGCT GGTCATCAAC GACTATTGGC AGGCCGCCAT CGACGCGGGC TGCGACTGGC TGCATCTGGG GCAAGAAGAT
CTGGATCAGG CCGATCTGCC CGCGATCCGC AAGGCGGGTC TGCGGCTGGG TGTCTCTACC CATGACGATG ACGAGTTGGA
GCGGGTTCTG GGCATGGACC CGGACTATGT CGCGCTGGGC CCGGTCTATC CGACCATCCT GAAACAGATG AAATGGCACC
AACAGGGCCT GCCGCGCGTG ACGGAATGGA AGGCGCGCGT GGGTTCCATC CCGCTGGTCG GTATCGGCGG CATGAGCGTC
GAGCGTGCGC CGGGCGTGCT GGGTGCCGGG GCCGATATCG TCTCGGTCGT CACCGACATC ACCTTGAATG CCGACCCCGA
GGCACGGGTG CACCAATGGA TCGAGGTCAC GAGATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7