Roseobase: Ruegeria pomeroyi DSS-3

Name: thiE
Type: CDS
Description: identified by similarity to SP:P30137; match to protein family HMM PF02581; match to protein family HMM TIGR00693; NCBI:thiamine phosphate synthase; IMG:thiamine-phosphate diphosphorylase
Source: GenBank
Position: DSS3:48842..49438 (+ strand)
Length: 597
Dbxref: GI:56694976
  GeneID:3194380
Note: identified by similarity to SP:P30137; match to protein family HMM PF02581; match to protein family HMM TIGR00693
  NCBI:thiamine phosphate synthase
  IMG:thiamine-phosphate diphosphorylase
codon_start: 1
eC_number: 2.5.1.3
load_id: SPO0048.p01
locus_tag: SPO0048
parent_id: SPO0048.t01
product: thiamine-phosphate pyrophosphorylase
protein_id: REF_tigr:SPO0048
  YP_165322.1
transl_table: 11
translation: MTLDRFYPIFDHTDWLRRMLPLGVKLVQLRIKDQSDPVIRAEIDTARDLCRAHGAVLVIN DYWQAAIDAGCDWLHLGQEDLDQADLPAIRKAGLRLGVSTHDDDELERVLGMDPDYVALG PVYPTILKQMKWHQQGLPRVTEWKARVGSIPLVGIGGMSVERAPGVLGAGADIVSVVTDI TLNADPEARVHQWIEVTR
>thiE class=Sequence position=DSS3:48842..49438 (+ strand)
ATGACGCTCG ACCGGTTTTA TCCGATCTTC GACCATACCG ACTGGCTGCG CCGGATGCTG CCGCTTGGGG TCAAGCTGGT
GCAGCTCAGG ATCAAGGACC AGTCCGACCC GGTGATCCGC GCCGAGATTG ACACCGCGCG CGACCTCTGC CGCGCGCATG
GCGCGGTGCT GGTCATCAAC GACTATTGGC AGGCCGCCAT CGACGCGGGC TGCGACTGGC TGCATCTGGG GCAAGAAGAT
CTGGATCAGG CCGATCTGCC CGCGATCCGC AAGGCGGGTC TGCGGCTGGG TGTCTCTACC CATGACGATG ACGAGTTGGA
GCGGGTTCTG GGCATGGACC CGGACTATGT CGCGCTGGGC CCGGTCTATC CGACCATCCT GAAACAGATG AAATGGCACC
AACAGGGCCT GCCGCGCGTG ACGGAATGGA AGGCGCGCGT GGGTTCCATC CCGCTGGTCG GTATCGGCGG CATGAGCGTC
GAGCGTGCGC CGGGCGTGCT GGGTGCCGGG GCCGATATCG TCTCGGTCGT CACCGACATC ACCTTGAATG CCGACCCCGA
GGCACGGGTG CACCAATGGA TCGAGGTCAC GAGATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7