Roseobase: Ruegeria pomeroyi DSS-3

Name: thiG
Type: gene
Description:
Source: GenBank
Position: DSS3:48081..48845 (+ strand)
Length: 765
Dbxref: GeneID:3195546
load_id: SPO0047
locus_tag: SPO0047
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:48081..48845 (+ strand)
Length: 765
load_id: SPO0047.t01
parent_id: SPO0047
Parts:
Type: CDS
Description: identified by similarity to SP:P30139; match to protein family HMM PF05690; NCBI:thiazole synthase; IMG:thiazole-phosphate synthase
Source: GenBank
Position: DSS3:48081..48845 (+ strand)
Length: 765
Dbxref: GI:56694975
  GeneID:3195546
Note: identified by similarity to SP:P30139; match to protein family HMM PF05690
  NCBI:thiazole synthase
  IMG:thiazole-phosphate synthase
codon_start: 1
load_id: SPO0047.p01
locus_tag: SPO0047
parent_id: SPO0047.t01
product: thiazole biosynthesis protein ThiG
protein_id: REF_tigr:SPO0047
  YP_165321.1
transl_table: 11
translation: MRAFYGTELPNPLMLGTAQYPSPAILEQAFRASGAGVATVSLRRESGAGQTFWSMIRDLG VLILPNTAGCHTVKEAVTTAHMAREVFGTPWIKLELIGHTDSLQPDVFGLIEAARILTED GFQVFPYTTDDLIVGERLLAAGCEVLMPWGAPIGSGRGLNNEYALRAMRAEFPDTPLVVD AGIGLPSHAARALELGYDAVLLNTAVARAGDPVEMARAMALAIQAGQLAHRADPIEARDM ASASTPVIGKAFLS
Type: exon
Description:
Source: GenBank
Position: DSS3:48081..48845 (+ strand)
Length: 765
parent_id: SPO0047.t01
> class=Sequence position=DSS3:48081..48845 (+ strand)
ATGCGCGCCT TTTACGGAAC CGAATTGCCG AACCCGCTGA TGCTGGGCAC CGCGCAATAT CCCAGCCCCG CGATCCTGGA
ACAGGCGTTT CGCGCTAGCG GGGCCGGGGT AGCCACCGTA TCGCTGCGGC GCGAATCCGG GGCTGGACAG ACCTTTTGGT
CGATGATCCG CGATCTGGGT GTGCTGATCC TGCCCAATAC CGCTGGTTGC CACACGGTGA AAGAGGCGGT GACCACCGCC
CATATGGCGC GCGAGGTCTT TGGCACGCCC TGGATCAAGC TGGAACTGAT CGGCCATACC GACAGCCTGC AACCGGATGT
CTTCGGCTTG ATCGAGGCTG CGCGCATTCT GACCGAAGAC GGGTTTCAGG TGTTTCCCTA TACGACTGAC GACCTGATCG
TCGGCGAACG GCTGCTGGCG GCGGGGTGCG AGGTGCTGAT GCCCTGGGGC GCGCCCATCG GCTCGGGCCG GGGGCTGAAC
AACGAATATG CGCTGCGCGC CATGCGGGCC GAGTTCCCGG ACACGCCTCT CGTGGTCGAT GCGGGCATCG GCCTTCCCAG
CCATGCCGCC CGTGCCTTGG AACTTGGCTA TGACGCGGTT CTGCTCAACA CCGCCGTGGC CCGTGCGGGC GACCCGGTGG
AGATGGCGCG CGCCATGGCA CTGGCCATTC AGGCCGGGCA ACTGGCGCAT CGCGCCGACC CGATCGAGGC ACGCGATATG
GCCAGCGCCT CAACCCCTGT GATCGGAAAG GCATTCCTGT CATGA
>thiG class=Sequence position=DSS3:48081..48845 (+ strand)
ATGCGCGCCT TTTACGGAAC CGAATTGCCG AACCCGCTGA TGCTGGGCAC CGCGCAATAT CCCAGCCCCG CGATCCTGGA
ACAGGCGTTT CGCGCTAGCG GGGCCGGGGT AGCCACCGTA TCGCTGCGGC GCGAATCCGG GGCTGGACAG ACCTTTTGGT
CGATGATCCG CGATCTGGGT GTGCTGATCC TGCCCAATAC CGCTGGTTGC CACACGGTGA AAGAGGCGGT GACCACCGCC
CATATGGCGC GCGAGGTCTT TGGCACGCCC TGGATCAAGC TGGAACTGAT CGGCCATACC GACAGCCTGC AACCGGATGT
CTTCGGCTTG ATCGAGGCTG CGCGCATTCT GACCGAAGAC GGGTTTCAGG TGTTTCCCTA TACGACTGAC GACCTGATCG
TCGGCGAACG GCTGCTGGCG GCGGGGTGCG AGGTGCTGAT GCCCTGGGGC GCGCCCATCG GCTCGGGCCG GGGGCTGAAC
AACGAATATG CGCTGCGCGC CATGCGGGCC GAGTTCCCGG ACACGCCTCT CGTGGTCGAT GCGGGCATCG GCCTTCCCAG
CCATGCCGCC CGTGCCTTGG AACTTGGCTA TGACGCGGTT CTGCTCAACA CCGCCGTGGC CCGTGCGGGC GACCCGGTGG
AGATGGCGCG CGCCATGGCA CTGGCCATTC AGGCCGGGCA ACTGGCGCAT CGCGCCGACC CGATCGAGGC ACGCGATATG
GCCAGCGCCT CAACCCCTGT GATCGGAAAG GCATTCCTGT CATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7