Roseobase: Ruegeria pomeroyi DSS-3

Name: ubiG
Type: gene
Description:
Source: Genbank
Position: CP000031.2:70268..71014 (+ strand)
Length: 747
gbkey: Gene
gene: ubiG
gene_biotype: protein_coding
load_id: gene-SPO0067
locus_tag: SPO0067
Parts:
Type: CDS
Description: identified by similarity to SP:P17993; match to protein family HMM TIGR01983
Source: Genbank
Position: CP000031.2:70268..71014 (+ strand)
Length: 747
Dbxref: NCBI_GP:AAV93398.1
IMG: ubiG: 3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)
Note: identified by similarity to SP:P17993; match to protein family HMM TIGR01983
RefSeq: SPO_RS00340: bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase
gbkey: CDS
gene: ubiG
load_id: cds-AAV93398.1
locus_tag: SPO0067
parent_id: gene-SPO0067
product: 3-demethylubiquinone-9 3-methyltransferase
protein_id: AAV93398.1
transl_table: 11
translation: MQAHPNTVDPSEIAKFEAMAAEWWDPHGKFKPLHMLNPCRLDYITRQIAGEFDRDLGTER PFAGLRLLDIGCGGGLLSEPMARLGAEVVGADAAEGNLPVARIHAEQSGLEIDYRHTTAE ALAEAGEQFDVVLNMEVVEHVADPLSYLRATHDLLKPGGLQICSTINRNPKSYAMAILGA EVVMRWLPRGTHDWSKFITPDELFDLLRQAGLEPVDRKGFVFNPISWQWSISDRDLSVNY VTASLRPR
>ubiG class=Sequence position=CP000031.2:70268..71014 (+ strand)
ATGCAAGCGC ATCCGAACAC GGTCGACCCA TCCGAGATCG CGAAATTCGA GGCGATGGCC GCCGAATGGT GGGATCCGCA
TGGCAAGTTC AAACCGCTGC ATATGCTCAA CCCTTGTCGG CTGGATTATA TCACCCGGCA GATCGCAGGT GAATTCGACC
GCGACCTTGG CACCGAGCGC CCCTTTGCCG GGCTGCGCCT GCTCGATATC GGTTGCGGTG GCGGGTTGCT CAGCGAACCG
ATGGCGCGGC TGGGGGCCGA GGTGGTCGGG GCCGATGCGG CCGAGGGCAA TCTGCCGGTG GCGCGCATCC ATGCGGAACA
GTCGGGCCTG GAGATCGACT ATCGCCACAC CACCGCCGAG GCGCTGGCCG AGGCGGGCGA GCAGTTCGAC GTCGTGCTGA
ACATGGAGGT GGTCGAGCAT GTGGCCGATC CGCTGTCCTA TCTGCGGGCA ACTCATGATC TGCTGAAACC GGGCGGGCTA
CAGATCTGCT CGACCATCAA CCGCAATCCC AAATCCTATG CGATGGCGAT CCTGGGGGCC GAGGTGGTGA TGCGCTGGCT
GCCGCGCGGA ACGCATGATT GGTCCAAATT CATCACCCCG GACGAGTTGT TCGACCTGCT GCGACAGGCG GGGCTGGAAC
CGGTGGACCG CAAGGGATTC GTGTTCAATC CGATCTCGTG GCAATGGTCG ATCTCGGACC GTGACCTGAG CGTGAACTAT
GTGACCGCCA GCCTGCGGCC CCGGTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7