Roseobase: Ruegeria pomeroyi DSS-3

Name: ubiG
Type: CDS
Description: identified by similarity to SP:P17993; match to protein family HMM TIGR01983; NCBI:bifunctional 3-demethylubiquinone 3-O-methyltransferase /2-octaprenyl-6-hydroxy phenol methylase; IMG:3-demethylubiquinone-9 3-methyltransferase
Source: GenBank
Position: DSS3:70268..71014 (+ strand)
Length: 747
Dbxref: GI:56694995
  GeneID:3196541
Note: identified by similarity to SP:P17993; match to protein family HMM TIGR01983
  NCBI:bifunctional 3-demethylubiquinone 3-O-methyltransferase /2-octaprenyl-6-hydroxy phenol methylase
  IMG:3-demethylubiquinone-9 3-methyltransferase
codon_start: 1
eC_number: 2.1.1.64
load_id: SPO0067.p01
locus_tag: SPO0067
parent_id: SPO0067.t01
product: 3-demethylubiquinone-9 3-methyltransferase
protein_id: REF_tigr:SPO0067
  YP_165341.1
transl_table: 11
translation: MQAHPNTVDPSEIAKFEAMAAEWWDPHGKFKPLHMLNPCRLDYITRQIAGEFDRDLGTER PFAGLRLLDIGCGGGLLSEPMARLGAEVVGADAAEGNLPVARIHAEQSGLEIDYRHTTAE ALAEAGEQFDVVLNMEVVEHVADPLSYLRATHDLLKPGGLQICSTINRNPKSYAMAILGA EVVMRWLPRGTHDWSKFITPDELFDLLRQAGLEPVDRKGFVFNPISWQWSISDRDLSVNY VTASLRPR
>ubiG class=Sequence position=DSS3:70268..71014 (+ strand)
ATGCAAGCGC ATCCGAACAC GGTCGACCCA TCCGAGATCG CGAAATTCGA GGCGATGGCC GCCGAATGGT GGGATCCGCA
TGGCAAGTTC AAACCGCTGC ATATGCTCAA CCCTTGTCGG CTGGATTATA TCACCCGGCA GATCGCAGGT GAATTCGACC
GCGACCTTGG CACCGAGCGC CCCTTTGCCG GGCTGCGCCT GCTCGATATC GGTTGCGGTG GCGGGTTGCT CAGCGAACCG
ATGGCGCGGC TGGGGGCCGA GGTGGTCGGG GCCGATGCGG CCGAGGGCAA TCTGCCGGTG GCGCGCATCC ATGCGGAACA
GTCGGGCCTG GAGATCGACT ATCGCCACAC CACCGCCGAG GCGCTGGCCG AGGCGGGCGA GCAGTTCGAC GTCGTGCTGA
ACATGGAGGT GGTCGAGCAT GTGGCCGATC CGCTGTCCTA TCTGCGGGCA ACTCATGATC TGCTGAAACC GGGCGGGCTA
CAGATCTGCT CGACCATCAA CCGCAATCCC AAATCCTATG CGATGGCGAT CCTGGGGGCC GAGGTGGTGA TGCGCTGGCT
GCCGCGCGGA ACGCATGATT GGTCCAAATT CATCACCCCG GACGAGTTGT TCGACCTGCT GCGACAGGCG GGGCTGGAAC
CGGTGGACCG CAAGGGATTC GTGTTCAATC CGATCTCGTG GCAATGGTCG ATCTCGGACC GTGACCTGAG CGTGAACTAT
GTGACCGCCA GCCTGCGGCC CCGGTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7