Roseobase: Celeribacter baekdonensis B30

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: B30:500000..600000, B30_00005, mepA, ZP_11131551, B30_t20113, rRNA, signal peptidase, TEGVEAILAALDEQDAQYKGPPRKIALAINKIDMVPVEKLLDMTKVLNERRN.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 15 regions match your request.
Matches on B30
overview_B30
rrmJ 23S rRNA methyltransferase J COG0293 23S rRNA methylase B30:1.319..1.32 Mbp (705 bp) score=20
B30_09453 putative tRNA/rRNA methyltransferase COG0565 rRNA methylase B30:1.943..1.944 Mbp (777 bp) score=20
rimM 16S rRNA-processing protein RimM COG0806 RimM protein, required for 16S rRNA processing B30:2.28..2.28 Mbp (510 bp) score=20
B30_01105 rRNA large subunit methyltransferase B30:217.8..218.3 kbp (471 bp) score=10
B30_02255 23S rRNA (uracil-5-)-methyltransferase RumA B30:472..473.3 kbp (1.218 kbp) score=10
gidB 16S rRNA methyltransferase GidB B30:494..494.6 kbp (618 bp) score=10
B30_03385 COG0144 tRNA and rRNA cytosine-C5-methylases B30:698.8..700.1 kbp (1.293 kbp) score=10
B30_04137 16S rRNA m(4)C1402 methyltransferase B30:868.7..869.7 kbp (1.011 kbp) score=10
B30_04272 COG0566 rRNA methylases B30:895.2..896 kbp (789 bp) score=10
B30_06036 COG1187 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases B30:1.243..1.244 Mbp (570 bp) score=10
B30_06736 COG0144 tRNA and rRNA cytosine-C5-methylases B30:1.381..1.383 Mbp (1.185 kbp) score=10
ksgA COG0030 Dimethyladenosine transferase (rRNA methylation) B30:1.897..1.898 Mbp (843 bp) score=10
B30_14544 COG1187 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases B30:2.992..2.993 Mbp (1.488 kbp) score=10
B30_18677 COG0030 Dimethyladenosine transferase (rRNA methylation) B30:3.844..3.848 Mbp (4.308 kbp) score=10
B30_20343 COG1187 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases B30:4.16..4.16 Mbp (477 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70