- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: ISM:2300000..2400000, ISM_00540, ISM_t17279, argJ, ZP_00960961, translation initiation factor, MCAWGSSTDLGGDIAIVGMALKVPGADGVDDFWR.

[Bookmark this] [Upload your own data] [Show banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 76 regions match your request.
Matches on ISM
overview_ISM
ISM_01090 COG0361 Translation initiation factor 1 (IF-1) translation initiation factor IF-1 ISM:219.1..219.4 kbp (219 bp) score=60
ISM_05575 COG0231 Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) elongation factor P ISM:1.132..1.132 Mbp (564 bp) score=60
ISM_06520 COG0532 Translation initiation factor 2 (IF-2; GTPase) translation initiation factor ISM:1.341..1.344 Mbp (2.436 kbp) score=60
ISM_15760 COG0290 Translation initiation factor 3 (IF-3) translation initiation factor ISM:3.252..3.253 Mbp (411 bp) score=60
ISM_01855 COG0050 GTPases - translation elongation factors translation elongation factor Tu ISM:351.4..352.6 kbp (1.176 kbp) score=40
ISM_01860 COG0480 Translation elongation factors (GTPases) translation elongation factor G ISM:352.7..354.8 kbp (2.118 kbp) score=40
ISM_01940 COG0050 GTPases - translation elongation factors translation elongation factor Tu ISM:373.6..374.8 kbp (1.176 kbp) score=40
ISM_11965 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB ISM:2.481..2.481 Mbp (450 bp) score=40
ISM_12350 COG1405 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB ISM:2.565..2.566 Mbp (288 bp) score=40
infB translation initiation factor IF-2 ISM:1.341..1.341 Mbp (144 bp) score=30
ISM_06830 COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) ISM:1.404..1.405 Mbp (687 bp) score=30
ISM_10166 COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) anti-anti-sigma factor ISM:2.098..2.098 Mbp (357 bp) score=30
tsf COG0264 Translation elongation factor Ts elongation factor Ts ISM:3.232..3.233 Mbp (855 bp) score=30
ISM_16690 COG0532 Translation initiation factor 2 (IF-2; GTPase) ISM:3.435..3.436 Mbp (1.056 kbp) score=30
ISM_01025 COG0251 Putative translation initiation inhibitor, yjgF family ISM:207.9..208.3 kbp (342 bp) score=20
ISM_01620 COG0480 Translation elongation factors (GTPases) ISM:320.3..320.4 kbp (120 bp) score=20
ISM_01770 COG0480 Translation elongation factors (GTPases) ISM:341.2..342.3 kbp (1.077 kbp) score=20
ISM_03510 COG0012 Predicted GTPase, probable translation factor ISM:696.7..697.8 kbp (1.098 kbp) score=20
ISM_04085 COG0251 Putative translation initiation inhibitor, yjgF family ISM:817.7..818.1 kbp (402 bp) score=20
tig COG0544 FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) trigger factor ISM:1.128..1.129 Mbp (1.332 kbp) score=20
dnaA COG0593 ATPase involved in DNA replication initiation chromosomal replication initiation protein ISM:1.19..1.191 Mbp (1.407 kbp) score=20
ISM_06415 COG0858 Ribosome-binding factor A ribosome-binding factor A ISM:1.319..1.319 Mbp (396 bp) score=20
ISM_06530 COG0195 Transcription elongation factor transcription elongation factor NusA ISM:1.345..1.346 Mbp (1.635 kbp) score=20
rho COG1158 Transcription termination factor transcription termination factor Rho ISM:1.386..1.387 Mbp (1.257 kbp) score=20
ISM_09000 COG0251 Putative translation initiation inhibitor, yjgF family ISM:1.85..1.851 Mbp (462 bp) score=20
ISM_09771 COG0009 Putative translation factor (SUA5) ISM:2.015..2.016 Mbp (954 bp) score=20
ISM_10056 COG1977 Molybdopterin converting factor, small subunit molybdopterin converting factor, subunit 1 ISM:2.078..2.078 Mbp (246 bp) score=20
ISM_10061 COG0314 Molybdopterin converting factor, large subunit Molybdopterin converting factor subunit 2 ISM:2.078..2.079 Mbp (459 bp) score=20
ISM_10161 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) anti-sigma B factor, putative ISM:2.097..2.098 Mbp (468 bp) score=20
ISM_10291 COG0251 Putative translation initiation inhibitor, yjgF family ISM:2.126..2.126 Mbp (450 bp) score=20
ISM_12570 COG0251 Putative translation initiation inhibitor, yjgF family ISM:2.609..2.609 Mbp (423 bp) score=20
ISM_13190 COG0782 Transcription elongation factor transcription elongation factor GreA ISM:2.728..2.728 Mbp (495 bp) score=20
ISM_13525 COG2896 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein A ISM:2.794..2.794 Mbp (915 bp) score=20
ISM_13575 COG0251 Putative translation initiation inhibitor, yjgF family ISM:2.803..2.803 Mbp (372 bp) score=20
ISM_14680 COG0216 Protein chain release factor A peptide chain release factor 1 ISM:3.024..3.025 Mbp (1.05 kbp) score=20
ISM_14775 COG0315 Molybdenum cofactor biosynthesis enzyme molybdenum cofactor biosynthesis protein C ISM:3.046..3.047 Mbp (477 bp) score=20
ISM_15015 COG0233 Ribosome recycling factor ribosome recycling factor ISM:3.101..3.102 Mbp (564 bp) score=20
ISM_15235 COG1186 Protein chain release factor B peptide chain release factor 2 ISM:3.146..3.148 Mbp (1.128 kbp) score=20
ISM_15935 COG4108 Peptide chain release factor RF-3 peptide chain release factor 3 ISM:3.286..3.287 Mbp (1.611 kbp) score=20
ISM_16040 COG1197 Transcription-repair coupling factor (superfamily II helicase) transcription-repair coupling factor ISM:3.302..3.306 Mbp (3.462 kbp) score=20
ISM_00070 RNA polymerase sigma factor ISM:12.22..13.11 kbp (897 bp) score=10
ISM_00110 COG0781 Transcription termination factor ISM:18.7..19.18 kbp (483 bp) score=10
ISM_00365 RNA polymerase sigma-70 factor ISM:71.22..71.77 kbp (549 bp) score=10
ISM_00370 COG5271 AAA ATPase containing von Willebrand factor type A (vWA) domain ISM:71.9..72.89 kbp (987 bp) score=10
ISM_00520 COG0593 ATPase involved in DNA replication initiation ISM:103..103.7 kbp (675 bp) score=10
ISM_00670 molybdenum cofactor biosynthesis domain protein ISM:135.6..136.4 kbp (789 bp) score=10
ISM_01570 RNA polymerase sigma-70 factor ISM:308.6..308.7 kbp (180 bp) score=10
ISM_01920 transcription termination/antitermination factor NusG ISM:371.1..371.6 kbp (534 bp) score=10
ISM_02015 chromosome replication initiation inhibitor protein ISM:388..388.9 kbp (897 bp) score=10
ISM_02885 RNA polymerase sigma factor ISM:564.7..565.6 kbp (834 bp) score=10
ISM_03110 COG3175 Cytochrome oxidase assembly factor ISM:615.5..616.1 kbp (582 bp) score=10
ISM_03120 COG0109 Polyprenyltransferase (cytochrome oxidase assembly factor) ISM:616.3..617.2 kbp (942 bp) score=10
ISM_03475 COG1198 Primosomal protein N' (replication factor Y) - superfamily II helicase ISM:688.7..691 kbp (2.289 kbp) score=10
ISM_03750 sigma factor sigB regulation protein ISM:748.8..749.8 kbp (1.017 kbp) score=10
ISM_04230 hemin degrading factor ISM:849.5..850.5 kbp (1.056 kbp) score=10
ISM_04790 Sigma factor sigB regulation protein rsbU ISM:973.8..974.7 kbp (975 bp) score=10
ISM_06965 COG1186 Protein chain release factor B ISM:1.437..1.437 Mbp (423 bp) score=10
ISM_09055 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) ISM:1.863..1.864 Mbp (906 bp) score=10
ISM_09326 COG4235 Cytochrome c biogenesis factor ISM:1.914..1.915 Mbp (1.239 kbp) score=10
ISM_09746 molybdenum cofactor biosynthesis protein B ISM:2.008..2.008 Mbp (543 bp) score=10
ISM_09976 COG0728 Uncharacterized membrane protein, putative virulence factor ISM:2.059..2.061 Mbp (1.548 kbp) score=10
ISM_11980 RNA polymerase sigma-70 factor ISM:2.482..2.483 Mbp (600 bp) score=10
ISM_12470 COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) ISM:2.585..2.587 Mbp (1.314 kbp) score=10
ISM_13010 RNA polymerase sigma factor ISM:2.69..2.692 Mbp (1.983 kbp) score=10
ISM_13870 integration host factor beta subunit ISM:2.855..2.855 Mbp (96 bp) score=10
ISM_13875 integration host factor, beta subunit ISM:2.855..2.856 Mbp (285 bp) score=10
ISM_14685 COG2890 Methylase of polypeptide chain release factors ISM:3.025..3.025 Mbp (828 bp) score=10
ISM_14735 COG1138 Cytochrome c biogenesis factor ISM:3.036..3.038 Mbp (1.974 kbp) score=10
ISM_14770 molybdenum cofactor biosynthesis protein A ISM:3.045..3.046 Mbp (1.173 kbp) score=10
ISM_15765 COG1975 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family ISM:3.253..3.254 Mbp (966 bp) score=10
ISM_16015 iron-sulfur cluster assembly transcription factor IscR, putative ISM:3.3..3.3 Mbp (432 bp) score=10
ISM_16330 COG1206 NAD(FAD)-utilizing enzyme possibly involved in translation ISM:3.362..3.363 Mbp (1.362 kbp) score=10
ISM_16390 integration host factor, alpha subunit ISM:3.375..3.375 Mbp (279 bp) score=10
ISM_16605 COG1923 Uncharacterized host factor I protein ISM:3.419..3.419 Mbp (240 bp) score=10
ISM_16840 COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) ISM:3.478..3.478 Mbp (408 bp) score=10
ISM_17215 COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor ISM:3.569..3.57 Mbp (771 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70