Roseobase: Rhodobacteraceae bacterium KLH11

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RKLH11:3100000..3200000, RKLH11_2615, atpA, ZP_05123317, transcriptional regulator, LLAIVGGAMAHARALIAGVLLLMSAAGMYYAFGFGVFTMFPIAFAGVAGFLGLAAGKPDEPKAHF.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 517 regions match your request.
Matches on RKLH11
overview_RKLH11
RKLH11_1742 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RKLH11:10.54..11.15 kbp (609 bp) score=40
RKLH11_2498 transcriptional regulator, GntR family [K] COG2188 Transcriptional regulators RKLH11:14.91..15.66 kbp (753 bp) score=40
RKLH11_2493 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RKLH11:15.67..16.12 kbp (459 bp) score=40
RKLH11_1746 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RKLH11:16.12..16.58 kbp (456 bp) score=40
RKLH11_1609 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RKLH11:104.4..104.8 kbp (492 bp) score=40
RKLH11_784 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:105.2..105.7 kbp (468 bp) score=40
RKLH11_930 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RKLH11:180.8..181.1 kbp (369 bp) score=40
RKLH11_1980 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RKLH11:181.3..181.7 kbp (402 bp) score=40
RKLH11_2990 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:208.1..208.7 kbp (591 bp) score=40
RKLH11_998 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:238.6..239.9 kbp (1.296 kbp) score=40
RKLH11_565 transcriptional regulator SoxR [K] COG0640 Predicted transcriptional regulators RKLH11:247.4..247.8 kbp (342 bp) score=40
RKLH11_1271 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:255..255.9 kbp (942 bp) score=40
RKLH11_106 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:392.8..393.7 kbp (915 bp) score=40
RKLH11_1572 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:407.3..408.2 kbp (882 bp) score=40
RKLH11_559 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:435.6..436.6 kbp (948 bp) score=40
RKLH11_161 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RKLH11:447.2..447.5 kbp (288 bp) score=40
RKLH11_335 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:479.8..480.4 kbp (597 bp) score=40
RKLH11_2981 transcriptional regulator, LysR family protein [K] COG0583 Transcriptional regulator RKLH11:531.9..532.9 kbp (975 bp) score=40
RKLH11_1424 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:568.8..569.4 kbp (555 bp) score=40
RKLH11_1541 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:669.6..670.1 kbp (462 bp) score=40
RKLH11_2334 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RKLH11:771.3..771.6 kbp (333 bp) score=40
RKLH11_1871 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:772.6..773.5 kbp (879 bp) score=40
RKLH11_315 transcriptional regulator, BadM/Rrf2 family [K] COG1959 Predicted transcriptional regulator RKLH11:802.9..803.3 kbp (405 bp) score=40
RKLH11_169 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RKLH11:838.6..839.2 kbp (648 bp) score=40
RKLH11_1831 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:842.2..842.7 kbp (510 bp) score=40
RKLH11_154 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:862.5..863.4 kbp (906 bp) score=40
RKLH11_788 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RKLH11:948.4..949.4 kbp (1.005 kbp) score=40
RKLH11_2590 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RKLH11:968.3..968.8 kbp (441 bp) score=40
RKLH11_2606 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:980.8..981.2 kbp (429 bp) score=40
RKLH11_2737 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.023..1.024 Mbp (894 bp) score=40
RKLH11_1404 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:1.032..1.033 Mbp (540 bp) score=40
RKLH11_2687 periplasmic binding protein/LacI transcriptional regulator [K] COG1609 Transcriptional regulators RKLH11:1.053..1.054 Mbp (1.035 kbp) score=40
RKLH11_635 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.059..1.06 Mbp (861 bp) score=40
RKLH11_2448 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.084..1.085 Mbp (921 bp) score=40
RKLH11_807 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RKLH11:1.125..1.126 Mbp (1.041 kbp) score=40
RKLH11_2740 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.286..1.287 Mbp (807 bp) score=40
RKLH11_472 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:1.287..1.288 Mbp (582 bp) score=40
RKLH11_1924 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:1.349..1.35 Mbp (591 bp) score=40
RKLH11_848 transcriptional regulator, XRE family with cupin sensor [K] COG1396 Predicted transcriptional regulators RKLH11:1.353..1.354 Mbp (636 bp) score=40
RKLH11_1896 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:1.364..1.365 Mbp (582 bp) score=40
RKLH11_625 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RKLH11:1.382..1.383 Mbp (654 bp) score=40
RKLH11_162 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:1.418..1.418 Mbp (459 bp) score=40
RKLH11_2042 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RKLH11:1.535..1.536 Mbp (1.026 kbp) score=40
RKLH11_2181 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RKLH11:1.566..1.566 Mbp (453 bp) score=40
RKLH11_1514 transcriptional regulatory protein, AsnC family [K] COG1522 Transcriptional regulators RKLH11:1.585..1.586 Mbp (444 bp) score=40
RKLH11_1994 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:1.595..1.596 Mbp (573 bp) score=40
RKLH11_1343 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.611..1.612 Mbp (939 bp) score=40
RKLH11_2279 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RKLH11:1.641..1.641 Mbp (330 bp) score=40
RKLH11_1545 transcriptional regulator [K] COG1309 Transcriptional regulator RKLH11:1.653..1.654 Mbp (594 bp) score=40
RKLH11_2180 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RKLH11:1.663..1.664 Mbp (684 bp) score=40
RKLH11_585 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RKLH11:1.749..1.749 Mbp (309 bp) score=40
RKLH11_596 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.781..1.782 Mbp (876 bp) score=40
cueR Cu(I)-responsive transcriptional regulator [K] COG0789 Predicted transcriptional regulators RKLH11:1.798..1.799 Mbp (390 bp) score=40
RKLH11_859 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.804..1.805 Mbp (900 bp) score=40
RKLH11_1121 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.811..1.812 Mbp (852 bp) score=40
RKLH11_1862 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:1.943..1.944 Mbp (897 bp) score=40
RKLH11_345 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:1.946..1.946 Mbp (462 bp) score=40
RKLH11_1720 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:1.991..1.991 Mbp (501 bp) score=40
metR transcriptional regulator MetR [K] COG0583 Transcriptional regulator RKLH11:2.033..2.034 Mbp (906 bp) score=40
RKLH11_1793 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:2.078..2.078 Mbp (879 bp) score=40
RKLH11_2522 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:2.08..2.08 Mbp (372 bp) score=40
RKLH11_871 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:2.104..2.105 Mbp (1.401 kbp) score=40
RKLH11_1024 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:2.216..2.217 Mbp (579 bp) score=40
RKLH11_199 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RKLH11:2.289..2.29 Mbp (1.083 kbp) score=40
RKLH11_1709 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:2.302..2.303 Mbp (588 bp) score=40
nrdR transcriptional regulator NrdR [K] COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains RKLH11:2.318..2.318 Mbp (471 bp) score=40
RKLH11_2846 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RKLH11:2.329..2.329 Mbp (321 bp) score=40
RKLH11_2718 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:2.5..2.5 Mbp (804 bp) score=40
RKLH11_1083 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RKLH11:2.546..2.547 Mbp (564 bp) score=40
RKLH11_2955 [K] COG1309 Transcriptional regulator; putative transcriptional regulatorTetR family taxon:164757 RKLH11:2.574..2.574 Mbp (567 bp) score=40
RKLH11_1872 transcriptional regulator, AraC family [K] COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain; overlaps another CDS with the same product name RKLH11:2.585..2.586 Mbp (864 bp) score=40
RKLH11_1761 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:2.651..2.652 Mbp (627 bp) score=40
RKLH11_933 transcriptional regulator/arsenate reductase [K] COG0640 Predicted transcriptional regulators RKLH11:2.653..2.654 Mbp (825 bp) score=40
RKLH11_228 transcriptional regulator, BadM/Rrf2 family [K] COG1959 Predicted transcriptional regulator RKLH11:2.761..2.761 Mbp (459 bp) score=40
RKLH11_2149 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:2.805..2.806 Mbp (912 bp) score=40
RKLH11_1546 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:2.904..2.905 Mbp (909 bp) score=40
RKLH11_1500 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:2.92..2.92 Mbp (903 bp) score=40
RKLH11_2457 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:2.952..2.952 Mbp (438 bp) score=40
RKLH11_2332 transcriptional regulator, RpiR family [K] COG1737 Transcriptional regulators RKLH11:2.96..2.961 Mbp (900 bp) score=40
RKLH11_2069 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:2.976..2.977 Mbp (924 bp) score=40
RKLH11_55 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:2.989..2.989 Mbp (912 bp) score=40
RKLH11_2452 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:2.994..2.994 Mbp (615 bp) score=40
RKLH11_1578 transcriptional regulator, DeoR family [KG] COG1349 Transcriptional regulators of sugar metabolism RKLH11:3.045..3.045 Mbp (801 bp) score=40
RKLH11_2708 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:3.051..3.052 Mbp (429 bp) score=40
RKLH11_1748 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:3.091..3.092 Mbp (609 bp) score=40
RKLH11_2756 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RKLH11:3.101..3.101 Mbp (489 bp) score=40
RKLH11_1974 transcriptional regulator, CarD family [K] COG1329 Transcriptional regulators, similar to M. xanthus CarD RKLH11:3.106..3.106 Mbp (513 bp) score=40
petP transcriptional regulator PetP [K] COG1846 Transcriptional regulators RKLH11:3.183..3.184 Mbp (513 bp) score=40
RKLH11_3167 negative transcriptional regulator [K] COG2808 Transcriptional regulator RKLH11:3.19..3.191 Mbp (615 bp) score=40
RKLH11_3486 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.202..3.202 Mbp (879 bp) score=40
RKLH11_3721 TetR-family transcriptional regulator [K] COG1309 Transcriptional regulator RKLH11:3.248..3.248 Mbp (600 bp) score=40
RKLH11_3144 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.267..3.268 Mbp (915 bp) score=40
RKLH11_3394 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RKLH11:3.284..3.285 Mbp (1.02 kbp) score=40
RKLH11_3704 periplasmic binding protein/LacI transcriptional regulator [K] COG1609 Transcriptional regulators RKLH11:3.304..3.305 Mbp (963 bp) score=40
RKLH11_3738 transcriptional regulator, LacI (ribose operon repressor) family [K] COG1609 Transcriptional regulators RKLH11:3.305..3.306 Mbp (1.02 kbp) score=40
RKLH11_3567 transcriptional regulator, LysR family protein [K] COG0583 Transcriptional regulator RKLH11:3.352..3.352 Mbp (393 bp) score=40
RKLH11_3588 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:3.386..3.387 Mbp (648 bp) score=40
RKLH11_3169 transcriptional regulator, DeoR family [KG] COG1349 Transcriptional regulators of sugar metabolism RKLH11:3.399..3.399 Mbp (792 bp) score=40
RKLH11_3161 transcriptional regulator, IclR family [K] COG0583 Transcriptional regulator RKLH11:3.418..3.419 Mbp (795 bp) score=40
RKLH11_3276 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RKLH11:3.442..3.443 Mbp (705 bp) score=40
RKLH11_3417 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RKLH11:3.478..3.479 Mbp (735 bp) score=40
RKLH11_3369 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RKLH11:3.488..3.489 Mbp (1.023 kbp) score=40
RKLH11_3750 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.509..3.51 Mbp (921 bp) score=40
RKLH11_3230 transcriptional regulatory protein [K] COG1802 Transcriptional regulators RKLH11:3.529..3.529 Mbp (660 bp) score=40
RKLH11_3664 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.531..3.532 Mbp (921 bp) score=40
RKLH11_3181 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RKLH11:3.557..3.557 Mbp (564 bp) score=40
RKLH11_3517 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.561..3.562 Mbp (867 bp) score=40
RKLH11_3569 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:3.569..3.569 Mbp (588 bp) score=40
RKLH11_3544 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.576..3.577 Mbp (924 bp) score=40
RKLH11_3166 transcriptional regulator, AraC family [K] COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RKLH11:3.686..3.687 Mbp (996 bp) score=40
RKLH11_3399 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RKLH11:3.697..3.698 Mbp (603 bp) score=40
RKLH11_3255 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.701..3.702 Mbp (987 bp) score=40
RKLH11_3455 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RKLH11:3.707..3.708 Mbp (693 bp) score=40
RKLH11_3480 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.708..3.709 Mbp (975 bp) score=40
RKLH11_3482 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.719..3.72 Mbp (891 bp) score=40
RKLH11_3703 transcriptional regulator, GntR family [K] COG2188 Transcriptional regulators RKLH11:3.773..3.774 Mbp (702 bp) score=40
RKLH11_3591 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.774..3.775 Mbp (876 bp) score=40
RKLH11_3501 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.784..3.785 Mbp (900 bp) score=40
RKLH11_3240 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.828..3.829 Mbp (915 bp) score=40
RKLH11_3837 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RKLH11:3.845..3.846 Mbp (1.035 kbp) score=40
RKLH11_3826 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.882..3.883 Mbp (885 bp) score=40
RKLH11_3928 [K] COG0583 Transcriptional regulator; putative transcriptional regulatorLysR family taxon:296591 RKLH11:3.946..3.947 Mbp (891 bp) score=40
RKLH11_3988 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:3.952..3.953 Mbp (993 bp) score=40
RKLH11_3990 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RKLH11:4.187..4.187 Mbp (651 bp) score=40
RKLH11_4027 ArsR-family transcriptional regulator [K] COG0640 Predicted transcriptional regulators RKLH11:4.246..4.246 Mbp (321 bp) score=40
RKLH11_3955 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:4.252..4.253 Mbp (870 bp) score=40
RKLH11_4005 putative LysR-family transcriptional regulator [K] COG0583 Transcriptional regulator RKLH11:4.253..4.254 Mbp (933 bp) score=40
RKLH11_4283 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RKLH11:4.333..4.334 Mbp (906 bp) score=40
RKLH11_149 transcriptional regulator, Crp/Fnr family [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RKLH11:49.02..49.69 kbp (669 bp) score=30
RKLH11_1318 transcriptional regulator, LuxR family protein [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RKLH11:219.5..220.8 kbp (1.251 kbp) score=30
RKLH11_2657 transcriptional regulator, LuxR family [T] COG4566 Response regulator RKLH11:240.1..240.6 kbp (537 bp) score=30
RKLH11_371 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:882.8..883.5 kbp (720 bp) score=30
RKLH11_770 regulatory protein, GntR [K] COG1802 Transcriptional regulators RKLH11:1.101..1.102 Mbp (1.029 kbp) score=30
hpaR homoprotocatechuate degradation operon regulator, HpaR [K] COG3432 Predicted transcriptional regulator RKLH11:1.127..1.128 Mbp (504 bp) score=30
soxR redox-sensitive transcriptional activator SoxR [K] COG0789 Predicted transcriptional regulators RKLH11:1.455..1.456 Mbp (468 bp) score=30
RKLH11_750 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:1.703..1.704 Mbp (687 bp) score=30
betI transcriptional repressor BetI [K] COG1309 Transcriptional regulator RKLH11:2.1..2.1 Mbp (558 bp) score=30
phoB phosphate regulon transcriptional regulatory protein PhoB [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:2.804..2.805 Mbp (690 bp) score=30
RKLH11_1390 autoinducer-binding transcriptional regulator, LuxR family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:2.819..2.82 Mbp (753 bp) score=30
RKLH11_2095 regulatory protein GntR, HTH [K] COG2186 Transcriptional regulators RKLH11:2.87..2.871 Mbp (732 bp) score=30
dctD C4-dicarboxylate transport transcriptional regulatory protein DctD [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RKLH11:2.886..2.887 Mbp (1.335 kbp) score=30
RKLH11_186 C4-dicarboxylate transport transcriptional regulatory protein [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RKLH11:2.948..2.949 Mbp (1.23 kbp) score=30
RKLH11_3156 transcriptional repressor CytR [K] COG1609 Transcriptional regulators RKLH11:3.314..3.315 Mbp (978 bp) score=30
RKLH11_3475 proline utilization regulator [K] COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RKLH11:3.326..3.327 Mbp (735 bp) score=30
RKLH11_3405 regulator of the anaerobic catobolism of benzoate BzdR [K] COG1396 Predicted transcriptional regulators RKLH11:3.472..3.473 Mbp (921 bp) score=30
RKLH11_3386 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:3.666..3.667 Mbp (714 bp) score=30
RKLH11_3376 proline dehydrogenase transcriptional activator [K] COG1522 Transcriptional regulators RKLH11:3.685..3.686 Mbp (324 bp) score=30
RKLH11_3754 regulatory protein GntR, HTH:GntR, C-terminal domain [K] COG2186 Transcriptional regulators RKLH11:3.743..3.744 Mbp (822 bp) score=30
RKLH11_4074 transcriptional repressor, CopY family [K] COG3682 Predicted transcriptional regulator RKLH11:4.226..4.226 Mbp (396 bp) score=30
RKLH11_1041 response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:238.1..238.5 kbp (381 bp) score=20
RKLH11_631 GcrA cell cycle regulator [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:273.8..274.4 kbp (573 bp) score=20
RKLH11_2857 response regulator receiver protein [KT] COG3279 Response regulator of the LytR/AlgR family RKLH11:342.8..343.6 kbp (738 bp) score=20
RKLH11_2381 [K] COG1737 Transcriptional regulators RKLH11:517.2..518.1 kbp (888 bp) score=20
RKLH11_1551 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:563.1..563.8 kbp (666 bp) score=20
RKLH11_1333 transcriptional regulator, AraC family RKLH11:609.6..610.6 kbp (1.002 kbp) score=20
RKLH11_854 [K] COG1959 Predicted transcriptional regulator RKLH11:629.1..629.6 kbp (447 bp) score=20
luxR_1 autoinducer-binding transcriptional regulator LuxR RKLH11:683.6..684.3 kbp (720 bp) score=20
RKLH11_2325 [K] COG1846 Transcriptional regulators RKLH11:706.3..706.8 kbp (507 bp) score=20
chvI DNA-binding response regulator ChvI [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:727.2..727.9 kbp (714 bp) score=20
pdhR [K] COG2186 Transcriptional regulators RKLH11:766.2..767 kbp (771 bp) score=20
RKLH11_802 [K] COG1476 Predicted transcriptional regulators RKLH11:827.1..827.6 kbp (444 bp) score=20
RKLH11_136 periplasmic binding protein/LacI transcriptional regulator RKLH11:947.3..948.2 kbp (951 bp) score=20
RKLH11_1467 nitrogen regulatory protein P-II [E] COG0347 Nitrogen regulatory protein PII RKLH11:1.028..1.028 Mbp (339 bp) score=20
RKLH11_708 response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:1.19..1.191 Mbp (1.275 kbp) score=20
hrcA [K] COG1420 Transcriptional regulator of heat shock gene RKLH11:1.201..1.202 Mbp (1.065 kbp) score=20
parB_1 [K] COG1475 Predicted transcriptional regulators RKLH11:1.205..1.205 Mbp (894 bp) score=20
regA photosynthetic apparatus regulatory protein RegA [NT] COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain RKLH11:1.239..1.239 Mbp (555 bp) score=20
RKLH11_2624 transcriptional regulator, XRE family with cupin sensor RKLH11:1.274..1.274 Mbp (585 bp) score=20
RKLH11_1679 [K] COG1678 Putative transcriptional regulator RKLH11:1.44..1.441 Mbp (675 bp) score=20
parB_2 [K] COG1475 Predicted transcriptional regulators RKLH11:1.544..1.545 Mbp (714 bp) score=20
parB_3 [K] COG1475 Predicted transcriptional regulators RKLH11:1.552..1.553 Mbp (747 bp) score=20
RKLH11_633 transcriptional regulator, LuxR family RKLH11:1.606..1.606 Mbp (813 bp) score=20
hutC [K] COG2188 Transcriptional regulators RKLH11:1.632..1.633 Mbp (705 bp) score=20
RKLH11_292 [K] COG1396 Predicted transcriptional regulators RKLH11:1.721..1.721 Mbp (519 bp) score=20
RKLH11_2545 transcriptional regulator, AraC family RKLH11:1.726..1.727 Mbp (984 bp) score=20
RKLH11_2672 [K] COG2378 Predicted transcriptional regulator; helix-turn-helix, type 11 RKLH11:1.732..1.733 Mbp (693 bp) score=20
tauR transcriptional regulator RKLH11:1.747..1.749 Mbp (1.461 kbp) score=20
fnrL transcriptional activator protein FnrL [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RKLH11:1.775..1.776 Mbp (756 bp) score=20
RKLH11_1691 transcriptional regulator, AraC family RKLH11:1.855..1.856 Mbp (1.014 kbp) score=20
RKLH11_668 transcriptional regulator, MarR family RKLH11:2.002..2.002 Mbp (414 bp) score=20
RKLH11_1781 response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:2.015..2.015 Mbp (714 bp) score=20
iclR [K] COG1414 Transcriptional regulator RKLH11:2.04..2.041 Mbp (846 bp) score=20
RKLH11_1262 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD [V] COG3023 Negative regulator of beta-lactamase expression RKLH11:2.073..2.074 Mbp (684 bp) score=20
RKLH11_341 [K] COG0583 Transcriptional regulator RKLH11:2.097..2.098 Mbp (897 bp) score=20
RKLH11_2072 [K] COG1522 Transcriptional regulators RKLH11:2.149..2.149 Mbp (174 bp) score=20
RKLH11_2928 [K] COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RKLH11:2.271..2.272 Mbp (780 bp) score=20
RKLH11_1053 transcriptional regulator, AraC family, putative RKLH11:2.314..2.315 Mbp (1.02 kbp) score=20
luxR_2 autoinducer-binding transcriptional regulator LuxR RKLH11:2.442..2.443 Mbp (702 bp) score=20
RKLH11_363 transcriptional regulator, TraR/DksA family RKLH11:2.458..2.459 Mbp (339 bp) score=20
scpB [K] COG1386 Predicted transcriptional regulator containing the HTH domain RKLH11:2.544..2.545 Mbp (657 bp) score=20
RKLH11_755 transcriptional regulator, AraC family RKLH11:2.585..2.585 Mbp (123 bp) score=20
RKLH11_448 [K] COG2378 Predicted transcriptional regulator; helix-turn-helix, type 11 RKLH11:2.602..2.603 Mbp (672 bp) score=20
ntrC [KE] COG3283 Transcriptional regulator of aromatic amino acids metabolism RKLH11:2.625..2.627 Mbp (1.368 kbp) score=20
ntrX [KT] COG3829 Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains RKLH11:2.629..2.631 Mbp (1.41 kbp) score=20
lexA [K] COG2932 Predicted transcriptional regulator RKLH11:2.691..2.692 Mbp (699 bp) score=20
RKLH11_1282 putative cAMP-binding protein - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinase [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RKLH11:2.733..2.733 Mbp (681 bp) score=20
RKLH11_1016 transcriptional regulator, AraC family RKLH11:2.792..2.793 Mbp (1.005 kbp) score=20
phoU phosphate transport system regulatory protein PhoU [P] COG0704 Phosphate uptake regulator RKLH11:2.803..2.804 Mbp (702 bp) score=20
RKLH11_2540 [K] COG0583 Transcriptional regulator RKLH11:2.833..2.834 Mbp (765 bp) score=20
RKLH11_1762 transcriptional regulator, GntR family RKLH11:2.839..2.84 Mbp (1.404 kbp) score=20
ctrA DNA-binding response regulator CtrA [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:2.852..2.852 Mbp (717 bp) score=20
RKLH11_300 [K] COG5007 Predicted transcriptional regulator, BolA superfamily RKLH11:2.91..2.91 Mbp (237 bp) score=20
RKLH11_1100 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:3.022..3.023 Mbp (681 bp) score=20
RKLH11_3151 [K] COG1414 Transcriptional regulator RKLH11:3.162..3.163 Mbp (780 bp) score=20
petR DNA-binding response regulator PetR [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RKLH11:3.182..3.183 Mbp (702 bp) score=20
RKLH11_3630 transcriptional regulator, AraC family RKLH11:3.185..3.186 Mbp (951 bp) score=20
RKLH11_3531 transcriptional regulator, LuxR family protein RKLH11:3.298..3.299 Mbp (1.134 kbp) score=20
RKLH11_3244 [K] COG1475 Predicted transcriptional regulators RKLH11:3.333..3.334 Mbp (1.107 kbp) score=20
RKLH11_3403 [K] COG5662 Predicted transmembrane transcriptional regulator (anti-sigma factor) RKLH11:3.422..3.422 Mbp (738 bp) score=20
RKLH11_3406 periplasmic binding protein/LacI transcriptional regulator RKLH11:3.447..3.448 Mbp (945 bp) score=20
RKLH11_3760 two component response regulator [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RKLH11:3.494..3.495 Mbp (714 bp) score=20
RKLH11_3210 transcriptional regulator, GntR family RKLH11:3.504..3.505 Mbp (852 bp) score=20
RKLH11_3174 transcriptional regulator, AraC family RKLH11:3.516..3.517 Mbp (1.014 kbp) score=20
RKLH11_3685 transcriptional regulator, AraC family RKLH11:3.713..3.714 Mbp (918 bp) score=20
RKLH11_3717 [K] COG1396 Predicted transcriptional regulators RKLH11:3.718..3.719 Mbp (582 bp) score=20
RKLH11_3152 [K] COG1396 Predicted transcriptional regulators RKLH11:3.732..3.733 Mbp (1.407 kbp) score=20
RKLH11_3677 two-component regulator [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RKLH11:3.83..3.83 Mbp (678 bp) score=20
RKLH11_3808 [K] COG1396 Predicted transcriptional regulators RKLH11:3.894..3.894 Mbp (630 bp) score=20
RKLH11_3782 transcriptional regulator, AraC family RKLH11:3.894..3.896 Mbp (1.173 kbp) score=20
RKLH11_3786 [K] COG0583 Transcriptional regulator RKLH11:3.903..3.904 Mbp (882 bp) score=20
RKLH11_4130 transcriptional regulator, AraC family RKLH11:3.961..3.963 Mbp (1.239 kbp) score=20
RKLH11_3885 [K] COG1396 Predicted transcriptional regulators RKLH11:3.967..3.967 Mbp (462 bp) score=20
RKLH11_3853 [K] COG1475 Predicted transcriptional regulators RKLH11:4.066..4.067 Mbp (1.794 kbp) score=20
RKLH11_4132 [K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain; putative putative addiction module antidote proteinCC2985 family RKLH11:4.135..4.136 Mbp (321 bp) score=20
RKLH11_3965 transcriptional regulator, AraC family RKLH11:4.176..4.177 Mbp (978 bp) score=20
RKLH11_4145 DNA-binding response regulator, LuxR family [T] COG4566 Response regulator RKLH11:4.197..4.198 Mbp (615 bp) score=20
RKLH11_3902 [K] COG1737 Transcriptional regulators RKLH11:4.235..4.236 Mbp (963 bp) score=20
RKLH11_4114 [K] COG1802 Transcriptional regulators RKLH11:4.263..4.264 Mbp (774 bp) score=20
RKLH11_3866 transcriptional regulator RKLH11:4.264..4.264 Mbp (456 bp) score=20
RKLH11_4117 [K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain RKLH11:4.278..4.278 Mbp (276 bp) score=20
RKLH11_4125 [K] COG2865 Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen RKLH11:4.29..4.291 Mbp (1.419 kbp) score=20
RKLH11_3948 [K] COG1475 Predicted transcriptional regulators RKLH11:4.291..4.292 Mbp (570 bp) score=20
RKLH11_4124 putative transcriptional regulator RKLH11:4.313..4.314 Mbp (1.071 kbp) score=20
RKLH11_4289 [K] COG1396 Predicted transcriptional regulators RKLH11:4.467..4.467 Mbp (336 bp) score=20
repB_2 [K] COG1475 Predicted transcriptional regulators RKLH11:4.469..4.47 Mbp (972 bp) score=20
RKLH11_1286 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:36.37..36.99 kbp (624 bp) score=10
ftsY [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:46.18..47.32 kbp (1.14 kbp) score=10
RKLH11_2005 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:69.08..69.42 kbp (336 bp) score=10
RKLH11_507 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:69.42..70.09 kbp (678 bp) score=10
nthA_1 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:70.09..70.7 kbp (615 bp) score=10
RKLH11_1412 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:93.79..94.41 kbp (615 bp) score=10
RKLH11_529 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:103.6..104.3 kbp (705 bp) score=10
RKLH11_182 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:153.2..153.4 kbp (171 bp) score=10
RKLH11_785 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:157.7..159.1 kbp (1.371 kbp) score=10
RKLH11_109 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:214.4..216.3 kbp (1.947 kbp) score=10
RKLH11_2974 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:284.2..284.5 kbp (333 bp) score=10
RKLH11_96 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:285.7..286.9 kbp (1.125 kbp) score=10
RKLH11_2982 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:299.3..300 kbp (768 bp) score=10
RKLH11_488 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RKLH11:326.4..327.3 kbp (870 bp) score=10
RKLH11_1013 response regulator receiver protein RKLH11:331.6..332.8 kbp (1.233 kbp) score=10
tolB [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:352.8..354.1 kbp (1.32 kbp) score=10
RKLH11_643 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:354.1..355.2 kbp (1.098 kbp) score=10
RKLH11_2941 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:382.9..383.7 kbp (801 bp) score=10
RKLH11_2430 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:418.7..419 kbp (354 bp) score=10
RKLH11_1801 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:421.9..422.5 kbp (537 bp) score=10
RKLH11_2918 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:422.7..423.2 kbp (477 bp) score=10
RKLH11_1648 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:451.8..452.3 kbp (510 bp) score=10
RKLH11_2040 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:467.9..468.7 kbp (753 bp) score=10
RKLH11_1991 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:468.7..469.2 kbp (459 bp) score=10
RKLH11_765 [K] COG3327 Phenylacetic acid-responsive transcriptional repressor RKLH11:485.1..485.9 kbp (801 bp) score=10
RKLH11_1453 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:520.8..521 kbp (258 bp) score=10
RKLH11_1620 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:533.1..533.6 kbp (540 bp) score=10
RKLH11_3053 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:545.3..546.3 kbp (990 bp) score=10
RKLH11_2110 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:550.8..551.5 kbp (753 bp) score=10
RKLH11_528 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:561.5..561.9 kbp (483 bp) score=10
RKLH11_2059 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:589.1..590 kbp (927 bp) score=10
RKLH11_727 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:602.5..603 kbp (495 bp) score=10
RKLH11_987 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:605.8..609.4 kbp (3.597 kbp) score=10
RKLH11_869 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:614.6..615 kbp (402 bp) score=10
RKLH11_771 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:617.4..617.8 kbp (399 bp) score=10
RKLH11_1177 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:629.7..630.2 kbp (579 bp) score=10
RKLH11_583 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:661.1..662.3 kbp (1.173 kbp) score=10
RKLH11_2044 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:679.8..680.5 kbp (783 bp) score=10
RKLH11_15 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:700.5..701.4 kbp (957 bp) score=10
RKLH11_1162 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:702.1..702.7 kbp (549 bp) score=10
RKLH11_1304 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:717.8..718 kbp (201 bp) score=10
RKLH11_1345 response regulator RKLH11:757.7..758.1 kbp (363 bp) score=10
RKLH11_2433 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:783.2..785.1 kbp (1.899 kbp) score=10
RKLH11_1999 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:801..801.3 kbp (321 bp) score=10
RKLH11_326 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:805.2..806.1 kbp (852 bp) score=10
RKLH11_317 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:816.2..816.7 kbp (468 bp) score=10
RKLH11_431 ADA regulatory protein RKLH11:854.7..855.5 kbp (843 bp) score=10
RKLH11_2185 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:857.3..858.1 kbp (840 bp) score=10
RKLH11_2616 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:873.2..873.5 kbp (348 bp) score=10
RKLH11_2991 sensor histidine kinase/response regulator RKLH11:920.2..922.5 kbp (2.247 kbp) score=10
RKLH11_440 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:922.5..924.6 kbp (2.043 kbp) score=10
RKLH11_1526 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:924.6..927.3 kbp (2.763 kbp) score=10
RKLH11_2746 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:944.1..944.7 kbp (618 bp) score=10
RKLH11_975 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:944.7..945.3 kbp (543 bp) score=10
RKLH11_2375 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:973.6..974.3 kbp (687 bp) score=10
ptsN PTS IIA-like nitrogen-regulatory protein PtsN RKLH11:974.4..974.9 kbp (465 bp) score=10
RKLH11_3044 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RKLH11:981.3..982 kbp (618 bp) score=10
RKLH11_1846 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:998.2..998.9 kbp (645 bp) score=10
RKLH11_423 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:999.1 kbp..1 Mbp (1.338 kbp) score=10
RKLH11_2603 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.003..1.004 Mbp (1.119 kbp) score=10
RKLH11_753 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.006..1.008 Mbp (2.184 kbp) score=10
RKLH11_2492 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.036..1.037 Mbp (1.578 kbp) score=10
RKLH11_2032 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.046..1.047 Mbp (870 bp) score=10
RKLH11_2871 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.047..1.048 Mbp (504 bp) score=10
RKLH11_2512 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.065..1.066 Mbp (507 bp) score=10
RKLH11_1503 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.104..1.119 Mbp (14.8 kbp) score=10
cyaCch [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.13..1.13 Mbp (144 bp) score=10
RKLH11_390 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.139..1.139 Mbp (351 bp) score=10
RKLH11_1732 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.175..1.176 Mbp (1.047 kbp) score=10
RKLH11_2271 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.176..1.177 Mbp (1.023 kbp) score=10
RKLH11_1308 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.177..1.179 Mbp (1.701 kbp) score=10
RKLH11_1211 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.223..1.223 Mbp (378 bp) score=10
RKLH11_2399 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.225..1.226 Mbp (363 bp) score=10
senC regulatory protein SenC RKLH11:1.238..1.239 Mbp (618 bp) score=10
RKLH11_1093 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.242..1.242 Mbp (315 bp) score=10
RKLH11_2789 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.245..1.245 Mbp (342 bp) score=10
RKLH11_2762 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.245..1.246 Mbp (444 bp) score=10
nodW two component response regulator RKLH11:1.262..1.262 Mbp (618 bp) score=10
RKLH11_2341 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.283..1.285 Mbp (2.691 kbp) score=10
RKLH11_921 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.288..1.288 Mbp (264 bp) score=10
RKLH11_475 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.307..1.308 Mbp (972 bp) score=10
RKLH11_2168 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.335..1.336 Mbp (813 bp) score=10
RKLH11_2984 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.373..1.374 Mbp (675 bp) score=10
RKLH11_388 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.408..1.409 Mbp (1.071 kbp) score=10
ytoQ [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.414..1.415 Mbp (447 bp) score=10
RKLH11_197 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.42..1.421 Mbp (1.26 kbp) score=10
RKLH11_2153 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; YHS RKLH11:1.426..1.427 Mbp (477 bp) score=10
RKLH11_316 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.461..1.461 Mbp (216 bp) score=10
RKLH11_1506 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.472..1.475 Mbp (2.541 kbp) score=10
RKLH11_1958 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.492..1.492 Mbp (306 bp) score=10
RKLH11_2006 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.495..1.496 Mbp (675 bp) score=10
RKLH11_1589 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.543..1.544 Mbp (900 bp) score=10
RKLH11_2745 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.56..1.56 Mbp (198 bp) score=10
RKLH11_2536 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.601..1.601 Mbp (801 bp) score=10
hutG [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.637..1.638 Mbp (798 bp) score=10
RKLH11_1909 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.641..1.642 Mbp (321 bp) score=10
RKLH11_2680 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.643..1.643 Mbp (513 bp) score=10
RKLH11_2707 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.646..1.646 Mbp (339 bp) score=10
RKLH11_460 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.672..1.672 Mbp (276 bp) score=10
RKLH11_91 [N] COG5442 Flagellar biosynthesis regulator FlaF RKLH11:1.674..1.675 Mbp (375 bp) score=10
RKLH11_37 [N] COG5443 Flagellar biosynthesis regulator FlbT RKLH11:1.675..1.675 Mbp (402 bp) score=10
RKLH11_139 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.675..1.676 Mbp (798 bp) score=10
RKLH11_1483 response regulator receiver protein RKLH11:1.678..1.678 Mbp (702 bp) score=10
RKLH11_730 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.681..1.682 Mbp (1.137 kbp) score=10
RKLH11_306 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.699..1.699 Mbp (486 bp) score=10
RKLH11_1782 [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RKLH11:1.718..1.719 Mbp (339 bp) score=10
RKLH11_1808 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.731..1.731 Mbp (366 bp) score=10
RKLH11_1332 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RKLH11:1.738..1.74 Mbp (1.983 kbp) score=10
RKLH11_2936 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.753..1.753 Mbp (489 bp) score=10
RKLH11_13 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.893..1.893 Mbp (654 bp) score=10
RKLH11_2256 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.895..1.895 Mbp (402 bp) score=10
RKLH11_2460 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.911..1.911 Mbp (171 bp) score=10
RKLH11_510 ATP phosphoribosyltransferase regulatory subunit RKLH11:1.913..1.914 Mbp (1.089 kbp) score=10
RKLH11_767 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.919..1.92 Mbp (804 bp) score=10
RKLH11_1194 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.928..1.934 Mbp (5.463 kbp) score=10
RKLH11_2002 response regulator receiver domain protein RKLH11:1.942..1.943 Mbp (477 bp) score=10
RKLH11_1285 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.952..1.953 Mbp (1.119 kbp) score=10
RKLH11_1947 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:1.985..1.986 Mbp (843 bp) score=10
RKLH11_2138 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; YHS RKLH11:2.031..2.031 Mbp (519 bp) score=10
RKLH11_2302 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.06..2.061 Mbp (1.089 kbp) score=10
RKLH11_818 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.062..2.063 Mbp (957 bp) score=10
RKLH11_2738 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.069..2.07 Mbp (678 bp) score=10
RKLH11_1984 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.109..2.109 Mbp (354 bp) score=10
RKLH11_752 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.118..2.119 Mbp (603 bp) score=10
RKLH11_229 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.139..2.139 Mbp (525 bp) score=10
RKLH11_826 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.142..2.143 Mbp (450 bp) score=10
RKLH11_1755 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.171..2.172 Mbp (1.047 kbp) score=10
RKLH11_948 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.237..2.237 Mbp (543 bp) score=10
RKLH11_90 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.275..2.275 Mbp (456 bp) score=10
RKLH11_327 response regulator receiver modulated diguanylate cyclase RKLH11:2.277..2.278 Mbp (1.401 kbp) score=10
RKLH11_1033 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.278..2.279 Mbp (285 bp) score=10
RKLH11_2779 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.279..2.28 Mbp (588 bp) score=10
RKLH11_219 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.287..2.289 Mbp (1.233 kbp) score=10
RKLH11_1645 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.316..2.317 Mbp (411 bp) score=10
RKLH11_1763 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.325..2.326 Mbp (1.056 kbp) score=10
RKLH11_1425 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.333..2.334 Mbp (273 bp) score=10
RKLH11_2479 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.336..2.337 Mbp (828 bp) score=10
RKLH11_379 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.348..2.348 Mbp (576 bp) score=10
RKLH11_778 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.355..2.355 Mbp (561 bp) score=10
RKLH11_144 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.355..2.356 Mbp (435 bp) score=10
RKLH11_108 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.356..2.356 Mbp (360 bp) score=10
RKLH11_66 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.356..2.357 Mbp (777 bp) score=10
RKLH11_227 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.363..2.365 Mbp (2.733 kbp) score=10
RKLH11_1268 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.37..2.371 Mbp (1.143 kbp) score=10
RKLH11_116 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.376..2.376 Mbp (132 bp) score=10
RKLH11_7 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.376..2.376 Mbp (225 bp) score=10
RKLH11_1256 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.381..2.382 Mbp (729 bp) score=10
RKLH11_1771 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.393..2.394 Mbp (1.428 kbp) score=10
RKLH11_2931 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.427..2.428 Mbp (345 bp) score=10
RKLH11_18 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.431..2.432 Mbp (783 bp) score=10
RKLH11_980 nitrogen regulatory protein P-II RKLH11:2.436..2.436 Mbp (339 bp) score=10
RKLH11_3047 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RKLH11:2.443..2.444 Mbp (450 bp) score=10
RKLH11_2557 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.458..2.458 Mbp (291 bp) score=10
RKLH11_2625 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.464..2.465 Mbp (687 bp) score=10
RKLH11_170 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.472..2.476 Mbp (3.393 kbp) score=10
RKLH11_356 DNA-binding response regulator, LuxR family RKLH11:2.505..2.505 Mbp (648 bp) score=10
phyB [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.505..2.507 Mbp (1.434 kbp) score=10
RKLH11_148 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.513..2.514 Mbp (426 bp) score=10
RKLH11_400 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.531..2.533 Mbp (1.365 kbp) score=10
RKLH11_124 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.541..2.542 Mbp (1.089 kbp) score=10
RKLH11_2416 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.55..2.55 Mbp (537 bp) score=10
RKLH11_2485 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.555..2.555 Mbp (489 bp) score=10
RKLH11_1462 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.574..2.575 Mbp (555 bp) score=10
RKLH11_1955 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.595..2.595 Mbp (363 bp) score=10
RKLH11_2515 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.616..2.617 Mbp (1.038 kbp) score=10
RKLH11_1644 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.646..2.647 Mbp (1.665 kbp) score=10
RKLH11_280 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.682..2.683 Mbp (678 bp) score=10
yibQ [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.696..2.698 Mbp (1.539 kbp) score=10
RKLH11_484 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.711..2.711 Mbp (246 bp) score=10
napD [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.73..2.731 Mbp (975 bp) score=10
RKLH11_194 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.735..2.737 Mbp (1.905 kbp) score=10
RKLH11_2988 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.74..2.74 Mbp (381 bp) score=10
cckA sensor histidine kinase/response regulator RKLH11:2.748..2.75 Mbp (2.292 kbp) score=10
RKLH11_1888 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.756..2.757 Mbp (504 bp) score=10
RKLH11_2194 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.807..2.808 Mbp (843 bp) score=10
RKLH11_1595 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.829..2.83 Mbp (519 bp) score=10
RKLH11_602 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.852..2.853 Mbp (261 bp) score=10
RKLH11_2323 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.871..2.871 Mbp (366 bp) score=10
RKLH11_1749 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.872..2.872 Mbp (435 bp) score=10
RKLH11_1787 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.88..2.881 Mbp (1.215 kbp) score=10
ccdA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.881..2.882 Mbp (753 bp) score=10
RKLH11_1518 [O] COG0425 Predicted redox protein, regulator of disulfide bond formation RKLH11:2.882..2.882 Mbp (234 bp) score=10
RKLH11_2193 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.882..2.885 Mbp (2.757 kbp) score=10
RKLH11_2833 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.911..2.911 Mbp (351 bp) score=10
RKLH11_222 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.923..2.924 Mbp (852 bp) score=10
RKLH11_83 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.932..2.933 Mbp (510 bp) score=10
RKLH11_2227 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.967..2.968 Mbp (660 bp) score=10
RKLH11_296 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.977..2.978 Mbp (1.098 kbp) score=10
RKLH11_1767 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:2.994..2.995 Mbp (939 bp) score=10
RKLH11_1504 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RKLH11:3.011..3.012 Mbp (645 bp) score=10
RKLH11_2217 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.015..3.017 Mbp (1.509 kbp) score=10
RKLH11_1497 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.035..3.036 Mbp (372 bp) score=10
RKLH11_295 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.045..3.046 Mbp (363 bp) score=10
RKLH11_1247 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.072..3.073 Mbp (555 bp) score=10
RKLH11_143 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.099..3.101 Mbp (1.902 kbp) score=10
RKLH11_3679 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.125..3.126 Mbp (1.25 kbp) score=10
RKLH11_3179 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.128..3.129 Mbp (1.701 kbp) score=10
RKLH11_3718 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.129..3.131 Mbp (2.106 kbp) score=10
RKLH11_3627 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.131..3.133 Mbp (1.881 kbp) score=10
RKLH11_3387 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.133..3.134 Mbp (642 bp) score=10
RKLH11_3746 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.135..3.138 Mbp (3.069 kbp) score=10
RKLH11_3349 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.143..3.143 Mbp (423 bp) score=10
RKLH11_3205 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.143..3.143 Mbp (156 bp) score=10
RKLH11_3449 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.143..3.144 Mbp (360 bp) score=10
RKLH11_3577 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.144..3.144 Mbp (441 bp) score=10
RKLH11_3220 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.17..3.172 Mbp (1.311 kbp) score=10
RKLH11_3187 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.2..3.201 Mbp (786 bp) score=10
ectC [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.203..3.204 Mbp (297 bp) score=10
RKLH11_3248 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.211..3.212 Mbp (1.194 kbp) score=10
RKLH11_3532 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.219..3.219 Mbp (348 bp) score=10
RKLH11_3748 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.254..3.256 Mbp (1.635 kbp) score=10
RKLH11_3502 sensory box sensor histidine kinase/response regulator RKLH11:3.268..3.27 Mbp (1.437 kbp) score=10
RKLH11_3635 two-component response regulator RKLH11:3.27..3.27 Mbp (396 bp) score=10
RKLH11_3711 response regulator receiver modulated serine phosphatase RKLH11:3.273..3.273 Mbp (978 bp) score=10
RKLH11_3457 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.286..3.287 Mbp (1.05 kbp) score=10
RKLH11_3217 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.289..3.289 Mbp (531 bp) score=10
RKLH11_3347 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.294..3.295 Mbp (1.002 kbp) score=10
RKLH11_3430 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.317..3.318 Mbp (294 bp) score=10
RKLH11_3609 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.42..3.421 Mbp (582 bp) score=10
RKLH11_3555 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.426..3.427 Mbp (1.077 kbp) score=10
RKLH11_3722 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.462..3.462 Mbp (561 bp) score=10
RKLH11_3184 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.473..3.474 Mbp (342 bp) score=10
RKLH11_3374 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.474..3.474 Mbp (660 bp) score=10
nthA_2 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.474..3.475 Mbp (642 bp) score=10
RKLH11_3247 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.524..3.525 Mbp (300 bp) score=10
RKLH11_3359 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.528..3.529 Mbp (711 bp) score=10
RKLH11_3689 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.552..3.553 Mbp (303 bp) score=10
RKLH11_3163 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.553..3.554 Mbp (1.137 kbp) score=10
RKLH11_3158 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.616..3.625 Mbp (8.487 kbp) score=10
RKLH11_3249 putative arylsulfatase regulator (Fe-S oxidoreductase) RKLH11:3.625..3.626 Mbp (1.587 kbp) score=10
RKLH11_3481 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RKLH11:3.632..3.633 Mbp (774 bp) score=10
RKLH11_3162 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.638..3.64 Mbp (2.295 kbp) score=10
RKLH11_3213 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.645..3.647 Mbp (2.046 kbp) score=10
RKLH11_3742 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.648..3.651 Mbp (3.846 kbp) score=10
RKLH11_3550 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.651..3.652 Mbp (813 bp) score=10
RKLH11_3548 sensory box histidine kinase/response regulator RKLH11:3.658..3.66 Mbp (1.896 kbp) score=10
RKLH11_3323 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.675..3.676 Mbp (672 bp) score=10
RKLH11_3425 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.706..3.707 Mbp (603 bp) score=10
RKLH11_3153 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.727..3.729 Mbp (1.191 kbp) score=10
RKLH11_3159 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.735..3.735 Mbp (489 bp) score=10
RKLH11_3678 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.759..3.759 Mbp (531 bp) score=10
RKLH11_3527 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.832..3.833 Mbp (1.134 kbp) score=10
RKLH11_3803 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.868..3.869 Mbp (1.194 kbp) score=10
RKLH11_3844 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.87..3.87 Mbp (615 bp) score=10
RKLH11_3810 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.87..3.872 Mbp (1.302 kbp) score=10
RKLH11_3831 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.891..3.892 Mbp (597 bp) score=10
RKLH11_3812 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.893..3.894 Mbp (1.068 kbp) score=10
RKLH11_4087 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.926..3.927 Mbp (324 bp) score=10
RKLH11_4055 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.929..3.93 Mbp (630 bp) score=10
RKLH11_3861 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.972..3.974 Mbp (1.824 kbp) score=10
RKLH11_3870 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.978..3.979 Mbp (540 bp) score=10
RKLH11_4189 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:3.987..3.989 Mbp (1.491 kbp) score=10
RKLH11_4192 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.009..4.01 Mbp (1.215 kbp) score=10
RKLH11_3876 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.016..4.016 Mbp (546 bp) score=10
RKLH11_3862 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.022..4.023 Mbp (714 bp) score=10
RKLH11_3895 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.032..4.033 Mbp (435 bp) score=10
RKLH11_3899 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.049..4.049 Mbp (243 bp) score=10
RKLH11_3898 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.05..4.05 Mbp (201 bp) score=10
RKLH11_4144 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.05..4.05 Mbp (339 bp) score=10
RKLH11_3894 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RKLH11:4.072..4.073 Mbp (885 bp) score=10
RKLH11_3851 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.08..4.118 Mbp (37.76 kbp) score=10
RKLH11_4076 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.131..4.132 Mbp (1.056 kbp) score=10
RKLH11_4082 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.139..4.141 Mbp (1.479 kbp) score=10
RKLH11_4168 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.145..4.146 Mbp (678 bp) score=10
RKLH11_3882 sensory box histidine kinase/response regulator RKLH11:4.194..4.196 Mbp (2.463 kbp) score=10
RKLH11_4010 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.198..4.2 Mbp (2.622 kbp) score=10
bapA_1 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.212..4.216 Mbp (4.083 kbp) score=10
RKLH11_4019 trans-acting regulatory protein HvrA RKLH11:4.224..4.224 Mbp (324 bp) score=10
RKLH11_3937 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.249..4.249 Mbp (633 bp) score=10
RKLH11_3886 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.262..4.263 Mbp (525 bp) score=10
bapA_2 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.286..4.289 Mbp (3.126 kbp) score=10
RKLH11_4142 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.289..4.289 Mbp (183 bp) score=10
bapA_3 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.307..4.311 Mbp (4.083 kbp) score=10
RKLH11_4306 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.329..4.33 Mbp (474 bp) score=10
RKLH11_4329 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.34..4.34 Mbp (357 bp) score=10
RKLH11_4277 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.341..4.342 Mbp (258 bp) score=10
RKLH11_4320 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RKLH11:4.371..4.372 Mbp (636 bp) score=10
RKLH11_4209 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.372..4.373 Mbp (1.119 kbp) score=10
frpC [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.418..4.427 Mbp (8.775 kbp) score=10
RKLH11_4264 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.438..4.438 Mbp (597 bp) score=10
RKLH11_4291 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.47..4.471 Mbp (1.152 kbp) score=10
RKLH11_4233 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RKLH11:4.483..4.486 Mbp (3.534 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70