Roseobase: Ruegeria pomeroyi DSS-3

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: DSS3:3962500..3963192, SPOA0355, dmdA, SPO_tRNA-Gly-5, SPO_Sp16SA, chromosome replication initiator, KAATLSIAAVFGLSLVFAVPSHVLLIQAVVLSGVLIFIWTRPNG.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 18 regions match your request.
Matches on DSS3
overview_DSS3
dnaA IMG:chromosomal replication initiator protein DnaA NCBI:chromosomal replication initiator protein DnaA chromosomal replication initiator protein DnaA DSS3:164.3..165.7 kbp (1.407 kbp) score=60
parA IMG:chromosome partitioning protein NCBI:chromosome partitioning protein ParA chromosome partitioning protein ParA DSS3:2.473..3.276 kbp (804 bp) score=30
parB IMG:chromosome segregation DNA-binding protein NCBI:chromosome partitioning protein ParB chromosome partitioning protein parB DSS3:3.299..4.189 kbp (891 bp) score=30
recF IMG:DNA replication and repair protein RecF NCBI:DNA replication /repair protein RecF DNA replication and repair protein RecF DSS3:167.2..168.3 kbp (1.101 kbp) score=30
SPOA0303 IMG:chromosome partitioning protein NCBI:replicationprotein replication protein DSS3:4.442..4.443 Mbp (1.098 kbp) score=30
SPO3228 IMG:chromosome segregation protein NCBI:chromosome segregation protein SMC DSS3:3.432..3.436 Mbp (3.456 kbp) score=20
repA NCBI:chromosomepartitioningproteinParA replication protein DSS3:4.443..4.444 Mbp (1.308 kbp) score=20
SPO0461 IMG:chromosome partitioning protein DSS3:471.3..471.9 kbp (630 bp) score=10
SPO0689 IMG:chromosome partitioning protein DSS3:718.8..719.7 kbp (810 bp) score=10
recN IMG:DNA replication and repair protein RecN DSS3:1.261..1.262 Mbp (1.65 kbp) score=10
SPO1803 IMG:ATP-binding protein involved in chromosome partitioning DSS3:1.92..1.922 Mbp (1.062 kbp) score=10
radA IMG:DNA replication and repair protein RadA DSS3:2.828..2.83 Mbp (1.362 kbp) score=10
SPO2990 IMG:replication restart DNA helicase PriA DSS3:3.187..3.188 Mbp (1.128 kbp) score=10
priA IMG:replication restart DNA helicase PriA DSS3:3.335..3.338 Mbp (2.211 kbp) score=10
SPO3196 IMG:DNA replication and repair protein RecO DSS3:3.409..3.41 Mbp (726 bp) score=10
recR IMG:DNA replication and repair protein RecR DSS3:3.781..3.782 Mbp (597 bp) score=10
SPOA0040 NCBI:chromosomecondensationproteinCrcB DSS3:4.146..4.147 Mbp (294 bp) score=10
SPOA0041 NCBI:chromosomecondensationproteinCcrB DSS3:4.147..4.147 Mbp (381 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70