- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: DSS3:3962500..3963192, SPOA0355, dmdA, SPO_tRNA-Gly-5, SPO_Sp16SA, chromosome replication initiator, KAATLSIAAVFGLSLVFAVPSHVLLIQAVVLSGVLIFIWTRPNG.

[Bookmark this] [Upload your own data] [Show banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 6 regions match your request.
Matches on CP000031.2
overview_CP000031.2
dnaA chromosomal replication initiator protein DnaA CP000031.2:164.3..165.7 kbp (1.407 kbp) score=20
parA chromosome partitioning protein ParA CP000031.2:2.473..3.276 kbp (804 bp) score=10
parB chromosome partitioning protein parB CP000031.2:3.299..4.189 kbp (891 bp) score=10
recF DNA replication and repair protein RecF CP000031.2:167.2..168.3 kbp (1.101 kbp) score=10
Matches on CP000032.1
overview_CP000032.1
SPOA0303 replication protein CP000032.1:332.2..333.3 kbp (1.098 kbp) score=10
repA replication protein CP000032.1:333.3..334.6 kbp (1.308 kbp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70