Roseobase: Ruegeria sp. TM1040

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: TM1040:3819290..3822502, TM1040_3663, IPR000445, dmdA, TM1040_R0002, TM1040_R0026, TM1040_R0028, transcriptional regulator, MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKEA.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 3 regions match your request.
Matches on TM1040
overview_TM1040
TM1040_2451 InterPro:IPR000445 TM1040:2.592..2.593 Mbp (744 bp) score=10
uvrC InterPro:IPR000445 TM1040:2.659..2.661 Mbp (1.908 kbp) score=10
TM1040_2645 InterPro:IPR000445 TM1040:2.779..2.78 Mbp (1.062 kbp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70