Roseobase: Ruegeria sp. TM1040

Showing 246 bp from TM1040, positions 4,093,405 to 4,093,650

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: TM1040:3819290..3822502, TM1040_3663, IPR000445, dmdA, TM1040_R0002, TM1040_R0026, TM1040_R0028, transcriptional regulator, MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKEA.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
Scroll/Zoom: