Ruegeria sp. TM1040: TM1040:2420155..2420613

Instructions Instructions Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed. Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position. Examples: TM1040:3819290..3822502, TM1040_3663, IPR000445, dmdA, TM1040_R0002, TM1040_R0026, TM1040_R0028, transcriptional regulator, MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKEA.
[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]

Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: TM1040:3819290..3822502, TM1040_3663, IPR000445, dmdA, TM1040_R0002, TM1040_R0026, TM1040_R0028, transcriptional regulator, MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKEA.


Landmark or Region:	Reports & Analysis:
Data Source	Scroll/Zoom: Flip

Roseobase: Ruegeria sp. TM1040

Showing 459 bp from TM1040, positions 2,420,155 to 2,420,613